Property Summary

NCBI Gene PubMed Count 77
PubMed Score 274.78
PubTator Score 152.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
DiGeorge syndrome 47 4.678 2.3
Mental disorders 12 0.0 0.0
Wilms Tumor 28 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 3.687 1.8
Velocardiofacial syndrome 46 3.675 1.8

Expression

  Differential Expression (7)

Disease log2 FC p
cystic fibrosis -1.200 4.4e-05
intraductal papillary-mucinous adenoma (... 1.400 1.8e-04
intraductal papillary-mucinous carcinoma... 1.200 7.4e-04
intraductal papillary-mucinous neoplasm ... 1.600 2.2e-03
osteosarcoma -1.348 1.3e-04
ovarian cancer 1.100 1.4e-04
psoriasis -1.100 2.7e-07

Gene RIF (56)

AA Sequence

METDESPSPLPCGPAGEAVMESRARPFQALPREQSPPPPLQTSSGAEVMDVGSGGDGQSELPAEDPFNFY      1 - 70
GASLLSKGSFSKGRLLIDPNCSGHSPRTARHAPAVRKFSPDLKLLKDVKISVSFTESCRSKDRKVLYTGA     71 - 140
ERDVRAECGLLLSPVSGDVHACPFGGSVGDGVGIGGESADKKDEENELDQEKRVEYAVLDELEDFTDNLE    141 - 210
LDEEGAGGFTAKAIVQRDRVDEEALNFPYEDDFDNDVDALLEEGLCAPKKRRTEEKYGGDSDHPSDGETS    211 - 280
VQPMMTKIKTVLKSRGRPPTEPLPDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSIRKHDPPLSSI    281 - 350
PCLHYKKMKDNEEREQSSDLTPSGDVSPVKPLSRSAELEFPLDEPDSMGADPGPPDEKDPLGAEAAPGAL    351 - 420
GQVKAKVEVCKDESVDLEEFRSYLEKRFDFEQVTVKKFRTWAERRQFNREMKRKQAESERPILPANQKLI    421 - 490
TLSVQDAPTKKEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVTIDGVTYGSGTASS    491 - 560
KKLAKNKAARATLEILIPDFVKQTSEEKPKDSEELEYFNHISIEDSRVYELTSKAGLLSPYQILHECLKR    561 - 630
NHGMGDTSIKFEVVPGKNQKSEYVMACGKHTVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGR    631 - 700
ESSKMVKQETSDKSVIELQQYAKKNKPNLHILSKLQEEMKRLAEEREETRKKPKMSIVASAQPGGEPLCT    701 - 770
VDV                                                                       771 - 773
//

Text Mined References (97)

PMID Year Title