Property Summary

NCBI Gene PubMed Count 65
Grant Count 76
R01 Count 48
Funding $8,481,384.98
PubMed Score 254.13
PubTator Score 152.69

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8WYQ5 B2R8G1 Q6DCB2 Q6MZE9 Q6Y2L0 Q96G39 Q96GP8 Q9H6L8 Q9H6T7 Q9NRW2
Symbols Gy1
pasha
DGCRK6
C22orf12

Gene

PDB

1X47   2YT4   3LE4   5B16  

Gene RIF (47)

PMID Text
26804549 Results demonstrated that DGCR8 is significantly upregulated in invasive ductal breast carcinoma, suggesting that increased expression of DGCR8 may play a fundamental role during the process of breast carcinogenesis.
26687677 Results show that DGCR8 forms an alternative complex with the RRP6-containing form of the exosome, acts as an adaptor to recruit the exosome to target structured RNAs, and the DGCR8/hRRP6 complex controls the stability of human telomerase RNA.
26683315 DGCR8 and Drosha assemble into a heterotrimeric complex on RNA, comprising two DGCR8 molecules and one Drosha molecule.
26126715 These results reveal a new pathway in the DNA damage response wherein ABL-dependent tyrosine phosphorylation of DGCR8 stimulates the processing of selective primary miRNAs.
26027739 Together with a 23-amino acid peptide from DGCR8, DROSHA constitutes a minimal functional core. DROSHA serves as a "ruler" by measuring 11 bp from the basal ssRNA-dsRNA junction. DGCR8 interacts with the stem and apical elements through its dsRNA-binding domains and RNA-binding heme domain, respectively, allowing efficient and accurate processing.
25823356 DGCR8 functions as an oncogene in ovarian cancer, which is in part mediated by miR-27b.
25670083 Recurrent mutations included a hotspot mutation (Q177R) in the homeo-domain of SIX1 and SIX2 in tumors with high proliferative potential (18.1% of blastemal cases); mutations in the DROSHA/DGCR8 microprocessor genes
25670082 in tumors with DGCR8 E518K and DROSHA exon 29 (miRNAPG-HS) mutations ... greater prevalence of tumors with blastemal predominant histology in patients with miRNAPG-HS and/or SIX1/2 Q177R mutations
25439752 We aimed to evaluate the expression of the major components of microRNA biogenesis machinery including Drosha, Dicer and DiGeorge syndrome critical region gene 8 (DGCR8) in multiple sclerosis patients
25427980 These data show that hepatitis B virus proteins repress DGCR8 promoter activity by upregulating the expression of transcription factor YY1.
More...

AA Sequence

METDESPSPLPCGPAGEAVMESRARPFQALPREQSPPPPLQTSSGAEVMDVGSGGDGQSELPAEDPFNFY      1 - 70
GASLLSKGSFSKGRLLIDPNCSGHSPRTARHAPAVRKFSPDLKLLKDVKISVSFTESCRSKDRKVLYTGA     71 - 140
ERDVRAECGLLLSPVSGDVHACPFGGSVGDGVGIGGESADKKDEENELDQEKRVEYAVLDELEDFTDNLE    141 - 210
LDEEGAGGFTAKAIVQRDRVDEEALNFPYEDDFDNDVDALLEEGLCAPKKRRTEEKYGGDSDHPSDGETS    211 - 280
VQPMMTKIKTVLKSRGRPPTEPLPDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSIRKHDPPLSSI    281 - 350
PCLHYKKMKDNEEREQSSDLTPSGDVSPVKPLSRSAELEFPLDEPDSMGADPGPPDEKDPLGAEAAPGAL    351 - 420
GQVKAKVEVCKDESVDLEEFRSYLEKRFDFEQVTVKKFRTWAERRQFNREMKRKQAESERPILPANQKLI    421 - 490
TLSVQDAPTKKEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVTIDGVTYGSGTASS    491 - 560
KKLAKNKAARATLEILIPDFVKQTSEEKPKDSEELEYFNHISIEDSRVYELTSKAGLLSPYQILHECLKR    561 - 630
NHGMGDTSIKFEVVPGKNQKSEYVMACGKHTVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGR    631 - 700
ESSKMVKQETSDKSVIELQQYAKKNKPNLHILSKLQEEMKRLAEEREETRKKPKMSIVASAQPGGEPLCT    701 - 770
VDV                                                                       771 - 773
//

Text Mined References (84)

PMID Year Title
26804549 2016 Upregulation of the double-stranded RNA binding protein DGCR8 in invasive ductal breast carcinoma.
26748718 2016 Structure of Human DROSHA.
26687677 2015 DGCR8 Acts as an Adaptor for the Exosome Complex to Degrade Double-Stranded Structured RNAs.
26683315 2016 A heterotrimer model of the complete Microprocessor complex revealed by single-molecule subunit counting.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26321680 2015 HNRNPA2B1 Is a Mediator of m(6)A-Dependent Nuclear RNA Processing Events.
26126715 2015 The kinase ABL phosphorylates the microprocessor subunit DGCR8 to stimulate primary microRNA processing in response to DNA damage.
26027739 2015 Functional Anatomy of the Human Microprocessor.
25823356 2015 Silencing the double-stranded RNA binding protein DGCR8 inhibits ovarian cancer cell proliferation, migration, and invasion.
25799998 2015 N6-methyladenosine marks primary microRNAs for processing.
More...