Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.679 0.000
medulloblastoma, large-cell 1.100 0.001
posterior fossa group B ependymoma 1.400 0.000

Synonym

Accession Q8WYQ4 Q6ICJ7
Symbols N27C7-3

Gene

 Compartment GO Term (1)

AA Sequence

MFIKVMFGAGCSVLVNTSCRLVNLTAHLRQKAGLPPDATIALLAEDGNLVSLEEDLKEGASRAQTMGNSL      1 - 70
LKERAIYVLVRIIKGEDMASTRYESLLENLDDHYPELAEELRRLSGLSSVGHNWRKRMGTRRGRHEQSPT     71 - 140
SRPRKGPD                                                                  141 - 148
//

Text Mined References (6)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.