Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.100 5.8e-04
osteosarcoma 1.679 1.1e-06
posterior fossa group B ependymoma 1.400 1.7e-07

AA Sequence

MFIKVMFGAGCSVLVNTSCRLVNLTAHLRQKAGLPPDATIALLAEDGNLVSLEEDLKEGASRAQTMGNSL      1 - 70
LKERAIYVLVRIIKGEDMASTRYESLLENLDDHYPELAEELRRLSGLSSVGHNWRKRMGTRRGRHEQSPT     71 - 140
SRPRKGPD                                                                  141 - 148
//

Text Mined References (6)

PMID Year Title