Property Summary

NCBI Gene PubMed Count 24
PubMed Score 48.88
PubTator Score 33.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.300 8.1e-04
astrocytic glioma -1.500 2.9e-03
atypical teratoid / rhabdoid tumor -1.100 4.1e-02
cystic fibrosis -1.472 9.6e-06
ependymoma -1.800 3.0e-02
glioblastoma -1.200 4.4e-06
group 3 medulloblastoma -1.900 5.4e-05
interstitial cystitis -1.200 1.3e-04
ovarian cancer 2.100 7.9e-06
pancreatic ductal adenocarcinoma liver m... -2.083 1.8e-03
Rheumatoid arthritis -1.400 1.5e-02

Gene RIF (19)

AA Sequence

MPRGSRSAASRPASRPAAPSAHPPAHPPPSAAAPAPAPSGQPGLMAQMATTAAGVAVGSAVGHVMGSALT      1 - 70
GAFSGGSSEPSQPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSS     71 - 140
LP                                                                        141 - 142
//

Text Mined References (23)

PMID Year Title