Property Summary

NCBI Gene PubMed Count 16
PubMed Score 28.57
PubTator Score 18.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Macrocephaly, Alopecia, Cutis Laxa, and Scoliosis 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Scoliosis 44 4.068 2.0

Expression

  Differential Expression (18)

Disease log2 FC p
acute quadriplegic myopathy 1.550 2.8e-07
astrocytoma 1.100 1.3e-15
Astrocytoma, Pilocytic 2.000 2.5e-07
autosomal dominant Emery-Dreifuss muscul... 1.087 9.2e-03
dermatomyositis 1.300 2.2e-03
Duchenne muscular dystrophy 1.169 5.3e-08
ependymoma 1.300 6.2e-07
intraductal papillary-mucinous adenoma (... 1.100 4.5e-02
invasive ductal carcinoma 1.388 1.4e-04
juvenile dermatomyositis 1.165 6.9e-11
lung cancer -2.400 1.2e-03
lung carcinoma -1.200 5.3e-16
medulloblastoma, large-cell -1.700 3.5e-03
ovarian cancer -1.300 8.8e-03
pediatric high grade glioma 1.100 8.7e-03
Pick disease 1.100 1.3e-04
pituitary cancer -1.100 1.3e-04
tuberculosis -1.400 2.5e-04

Protein-protein Interaction (2)

Gene RIF (4)

AA Sequence

MTAWTMGARGLDKRGSFFKLIDTIASEIGELKQEMVRTDVNLENGLEPAETHSMVRHKDGGYSEEEDVKT      1 - 70
CARDSGYDSLSNRLSILDRLLHTHPIWLQLSLSEEEAAEVLQAQPPGIFLVHKSTKMQKKVLSLRLPCEF     71 - 140
GAPLKEFAIKESTYTFSLEGSGISFADLFRLIAFYCISRDVLPFTLKLPYAISTAKSEAQLEELAQMGLN    141 - 210
FWSSPADSKPPNLPPPHRPLSSDGVCPASLRQLCLINGVHSIKTRTPSELECSQTNGALCFINPLFLKVH    211 - 280
SQDLSGGLKRPSTRTPNANGTERTRSPPPRPPPPAINSLHTSPRLARTETQTSMPETVNHNKHGNVALPG    281 - 350
TKPTPIPPPRLKKQASFLEAEGGAKTLSGGRPGAGPELELGTAGSPGGAPPEAAPGDCTRAPPPSSESRP    351 - 420
PCHGGRQRLSDMSISTSSSDSLEFDRSMPLFGYEADTNSSLEDYEGESDQETMAPPIKSKKKRSSSFVLP    421 - 490
KLVKSQLQKVSGVFSSFMTPEKRMVRRIAELSRDKCTYFGCLVQDYVSFLQENKECHVSSTDMLQTIRQF    491 - 560
MTQVKNYLSQSSELDPPIESLIPEDQIDVVLEKAMHKCILKPLKGHVEAMLKDFHMADGSWKQLKENLQL    561 - 630
VRQRNPQELGVFAPTPDFVDVEKIKVKFMTMQKMYSPEKKVMLLLRVCKLIYTVMENNSGRMYGADDFLP    631 - 700
VLTYVIAQCDMLELDTEIEYMMELLDPSLLHGEGGYYLTSAYGALSLIKNFQEEQAARLLSSETRDTLRQ    701 - 770
WHKRRTTNRTIPSVDDFQNYLRVAFQEVNSGCTGKTLLVRPYITTEDVCQICAEKFKVGDPEEYSLFLFV    771 - 840
DETWQQLAEDTYPQKIKAELHSRPQPHIFHFVYKRIKNDPYGIIFQNGEEDLTTS                   841 - 895
//

Text Mined References (18)

PMID Year Title