Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.29
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
breast carcinoma 1614 2.39011838138986E-22
Breast cancer 3099 3.75946275035706E-22
lung carcinoma 2844 1.37382111776514E-20
oligodendroglioma 2849 2.48959847575565E-10
malignant mesothelioma 3163 9.40150792417612E-8
lung cancer 4473 7.00628508235813E-7
pituitary cancer 1972 1.05556586850579E-6
ovarian cancer 8492 4.42404112011585E-5
sonic hedgehog group medulloblastoma 1482 1.96221214863791E-4
glioblastoma 5572 7.26023803232329E-4
pediatric high grade glioma 2712 0.00168587026644232
invasive ductal carcinoma 2950 0.00244040202000618
osteosarcoma 7933 0.00358833830860308
pilocytic astrocytoma 3086 0.00360551447217277
Pick disease 1893 0.00533636452737939
atypical teratoid / rhabdoid tumor 4369 0.00533852280548474
ependymoma 2514 0.00640388558198791
ductal carcinoma in situ 1745 0.00806940298462589
aldosterone-producing adenoma 664 0.0160567869263699
progressive supranuclear palsy 674 0.0160946219736533
medulloblastoma, large-cell 6234 0.0190361371304958
astrocytic glioma 2241 0.0212396481523392
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.044714906261031
Alzheimer's disease 644 0.0497357704771641

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma -2.600 0.000
astrocytic glioma -1.600 0.021
ependymoma -1.400 0.006
glioblastoma -3.000 0.001
oligodendroglioma -1.500 0.000
osteosarcoma 2.575 0.004
sonic hedgehog group medulloblastoma -2.300 0.000
atypical teratoid / rhabdoid tumor -3.400 0.005
medulloblastoma, large-cell -2.100 0.019
intraductal papillary-mucinous carcinoma... -1.500 0.045
lung cancer 4.400 0.000
pediatric high grade glioma -2.200 0.002
pilocytic astrocytoma -1.500 0.004
aldosterone-producing adenoma -1.243 0.016
Breast cancer -3.100 0.000
lung carcinoma 2.900 0.000
breast carcinoma -1.800 0.000
Alzheimer's disease 1.400 0.050
Pick disease 1.900 0.005
progressive supranuclear palsy 1.700 0.016
ductal carcinoma in situ -1.300 0.008
invasive ductal carcinoma -2.300 0.002
ovarian cancer 1.300 0.000
pituitary cancer 1.500 0.000

Synonym

Accession Q8WYN3 B3KPR4 Q53SG0 Q6ZTX3 Q9HAF9 CSRNP-3
Symbols TAIP2
TAIP-2
PPP1R73
FAM130A2

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Horse OMA Inparanoid
Pig OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
20468071 Observational study of gene-disease association. (HuGE Navigator)
19401682 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSGILKRKFEEVDGSSPCSSVRESDDEVSSSESADSGDSVNPSTSSHFTPSSILKREKRLRTKNVHFSCV      1 - 70
TVYYFTRRQGFTSVPSQGGSTLGMSSRHNSVRQYTLGEFAREQERLHREMLREHLREEKLNSLKLKMTKN     71 - 140
GTVESEEASTLTLDDISDDDIDLDNTEVDEYFFLQPLPTKKRRALLRASGVKKIDVEEKHELRAIRLSRE    141 - 210
DCGCDCRVFCDPDTCTCSLAGIKCQVDRMSFPCGCTKEGCSNTAGRIEFNPIRVRTHFLHTIMKLELEKN    211 - 280
REQQIPTLNGCHSEISAHSSSMGPVAHSVEYSIADSFEIETEPQAAVLHLQSAEELDCQGEEEEEEEDGS    281 - 350
SFCSGVTDSSTQSLAPSESDEEEEEEEEEEEEEDDDDDKGDGFVEGLGTHAEVVPLPSVLCYSDGTAVHE    351 - 420
SHAKNASFYANSSTLYYQIDSHIPGTPNQISENYSERDTVKNGTLSLVPYTMTPEQFVDYARQAEEAYGA    421 - 490
SHYPAANPSVIVCCSSSENDSGVPCNSLYPEHRSNHPQVEFHSYLKGPSQEGFVSALNGDSHISEHPAEN    491 - 560
SLSLAEKSILHEECIKSPVVETVPV                                                 561 - 585
//

Text Mined References (10)

PMID Year Title
24688116 2014 Genome-wide association meta-analysis of human longevity identifies a novel locus conferring survival beyond 90 years of age.
20468071 2010 Evidence for genes on chromosome 2 contributing to alcohol dependence with conduct disorder and suicide attempts.
19401682 2010 High-density SNP association study and copy number variation analysis of the AUTS1 and AUTS5 loci implicate the IMMP2L-DOCK4 gene region in autism susceptibility.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17726538 2007 Characterization of a family of novel cysteine- serine-rich nuclear proteins (CSRNP).
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.