Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.49
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma -2.100 4.1e-03
aldosterone-producing adenoma -1.243 1.6e-02
Alzheimer's disease 1.400 5.0e-02
astrocytic glioma -1.500 9.8e-03
Astrocytoma, Pilocytic -1.400 6.5e-04
atypical teratoid / rhabdoid tumor -1.900 1.7e-02
Breast cancer -1.500 1.7e-25
breast carcinoma -1.200 5.5e-19
ductal carcinoma in situ -1.100 2.1e-02
ependymoma -1.400 6.4e-03
glioblastoma -1.600 1.6e-05
group 4 medulloblastoma -1.300 3.8e-02
intraductal papillary-mucinous carcinoma... -1.500 4.5e-02
invasive ductal carcinoma -1.200 3.6e-02
lung cancer 1.600 6.6e-04
lung carcinoma 2.900 1.4e-20
malignant mesothelioma -2.600 9.4e-08
medulloblastoma, large-cell -1.900 1.6e-02
oligodendroglioma -1.300 1.0e-11
osteosarcoma 1.006 4.3e-02
ovarian cancer 1.300 4.4e-05
Pick disease 1.900 5.3e-03
pituitary cancer 1.500 1.1e-06
progressive supranuclear palsy 1.700 1.6e-02

Gene RIF (2)

AA Sequence

MSGILKRKFEEVDGSSPCSSVRESDDEVSSSESADSGDSVNPSTSSHFTPSSILKREKRLRTKNVHFSCV      1 - 70
TVYYFTRRQGFTSVPSQGGSTLGMSSRHNSVRQYTLGEFAREQERLHREMLREHLREEKLNSLKLKMTKN     71 - 140
GTVESEEASTLTLDDISDDDIDLDNTEVDEYFFLQPLPTKKRRALLRASGVKKIDVEEKHELRAIRLSRE    141 - 210
DCGCDCRVFCDPDTCTCSLAGIKCQVDRMSFPCGCTKEGCSNTAGRIEFNPIRVRTHFLHTIMKLELEKN    211 - 280
REQQIPTLNGCHSEISAHSSSMGPVAHSVEYSIADSFEIETEPQAAVLHLQSAEELDCQGEEEEEEEDGS    281 - 350
SFCSGVTDSSTQSLAPSESDEEEEEEEEEEEEEDDDDDKGDGFVEGLGTHAEVVPLPSVLCYSDGTAVHE    351 - 420
SHAKNASFYANSSTLYYQIDSHIPGTPNQISENYSERDTVKNGTLSLVPYTMTPEQFVDYARQAEEAYGA    421 - 490
SHYPAANPSVIVCCSSSENDSGVPCNSLYPEHRSNHPQVEFHSYLKGPSQEGFVSALNGDSHISEHPAEN    491 - 560
SLSLAEKSILHEECIKSPVVETVPV                                                 561 - 585
//

Text Mined References (10)

PMID Year Title