Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.29
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma -2.600 0.000
astrocytic glioma -1.600 0.021
ependymoma -1.400 0.006
glioblastoma -3.000 0.001
oligodendroglioma -1.500 0.000
osteosarcoma 2.575 0.004
sonic hedgehog group medulloblastoma -2.300 0.000
atypical teratoid / rhabdoid tumor -3.400 0.005
medulloblastoma, large-cell -2.100 0.019
intraductal papillary-mucinous carcinoma... -1.500 0.045
lung cancer 4.400 0.000
pediatric high grade glioma -2.200 0.002
pilocytic astrocytoma -1.500 0.004
aldosterone-producing adenoma -1.243 0.016
Breast cancer -3.100 0.000
lung carcinoma 2.900 0.000
breast carcinoma -1.800 0.000
Alzheimer's disease 1.400 0.050
Pick disease 1.900 0.005
progressive supranuclear palsy 1.700 0.016
ductal carcinoma in situ -1.300 0.008
invasive ductal carcinoma -2.300 0.002
ovarian cancer 1.300 0.000
pituitary cancer 1.500 0.000

Gene RIF (2)

PMID Text
20468071 Observational study of gene-disease association. (HuGE Navigator)
19401682 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSGILKRKFEEVDGSSPCSSVRESDDEVSSSESADSGDSVNPSTSSHFTPSSILKREKRLRTKNVHFSCV      1 - 70
TVYYFTRRQGFTSVPSQGGSTLGMSSRHNSVRQYTLGEFAREQERLHREMLREHLREEKLNSLKLKMTKN     71 - 140
GTVESEEASTLTLDDISDDDIDLDNTEVDEYFFLQPLPTKKRRALLRASGVKKIDVEEKHELRAIRLSRE    141 - 210
DCGCDCRVFCDPDTCTCSLAGIKCQVDRMSFPCGCTKEGCSNTAGRIEFNPIRVRTHFLHTIMKLELEKN    211 - 280
REQQIPTLNGCHSEISAHSSSMGPVAHSVEYSIADSFEIETEPQAAVLHLQSAEELDCQGEEEEEEEDGS    281 - 350
SFCSGVTDSSTQSLAPSESDEEEEEEEEEEEEEDDDDDKGDGFVEGLGTHAEVVPLPSVLCYSDGTAVHE    351 - 420
SHAKNASFYANSSTLYYQIDSHIPGTPNQISENYSERDTVKNGTLSLVPYTMTPEQFVDYARQAEEAYGA    421 - 490
SHYPAANPSVIVCCSSSENDSGVPCNSLYPEHRSNHPQVEFHSYLKGPSQEGFVSALNGDSHISEHPAEN    491 - 560
SLSLAEKSILHEECIKSPVVETVPV                                                 561 - 585
//

Text Mined References (10)

PMID Year Title
24688116 2014 Genome-wide association meta-analysis of human longevity identifies a novel locus conferring survival beyond 90 years of age.
20468071 2010 Evidence for genes on chromosome 2 contributing to alcohol dependence with conduct disorder and suicide attempts.
19401682 2010 High-density SNP association study and copy number variation analysis of the AUTS1 and AUTS5 loci implicate the IMMP2L-DOCK4 gene region in autism susceptibility.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17726538 2007 Characterization of a family of novel cysteine- serine-rich nuclear proteins (CSRNP).
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.