Property Summary

NCBI Gene PubMed Count 18
PubMed Score 7.89
PubTator Score 8.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
lung cancer 4,466
osteosarcoma 7,933

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.208 0.001
lung cancer -1.600 0.000

Gene RIF (11)

PMID Text
25490467 HIV-1 Vif binds more strongly to autophagy-related protein 4 (ATG4)-cleaved form I (LC3-I) than to ATG4-cleaved form II (LC3-II) in an A3G-independent manner
25426560 We conclude that miR-24-3p regulates autophagy by targeting ATG4A
24256813 The demonstration that expression of ATG4A in cells increased stem properties provided an indication of its biological function. Hypomethylation of ATG4A and HIST1H2BN in ovarian tumor-initiating cells predicts poor prognosis for ovarian cancer patients.
24229464 The autophagy regulator ATG4A was found to be essential for the maintenance of a sub-population with cancer stem cell properties and to regulate breast cancer cell tumourigenicity.
23508006 The actions of ATG4 family members (particularly ATG4B) are required for the control of autophagosome fusion with late, degradative compartments in differentiating human erythroblasts.
21297227 statistical analysis of APG4A gene confirmed the characterisation of each protein-coding gene present in human genome Xq22.1
21177865 Atg4B possessed the broadest spectrum against all substrates, followed by Atg4A for ATG8 substrates
21122541 no association between SNP rs807185 and the presence of granulomas in Crohn's disease
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17347651 The cysteine protease HsAtg4 is identified as a direct target for oxidation by hydrogen peroxide, and a cysteine residue located near the HsAtg4 catalytic site as critical for this regulation.
More...

AA Sequence

MESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTGPS      1 - 70
SDAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDRKDCCYSIHQMAQMGVGEGK     71 - 140
SIGEWFGPNTVAQVLKKLALFDEWNSLAVYVSMDNTVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQS    141 - 210
KGTSAYCSAWKPLLLIVPLRLGINQINPVYVDAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDP    211 - 280
HTTQTFVDTEENGTVNDQTFHCLQSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFE    281 - 350
LVQKHPSHWPPFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV                          351 - 398
//

Text Mined References (20)

PMID Year Title
25426560 2015 Mir-24-3p downregulation contributes to VP16-DDP resistance in small-cell lung cancer by targeting ATG4A.
25416956 2014 A proteome-scale map of the human interactome network.
24256813 2014 Hypomethylation signature of tumor-initiating cells predicts poor prognosis of ovarian cancer patients.
24229464 2013 A mammosphere formation RNAi screen reveals that ATG4A promotes a breast cancer stem-like phenotype.
23508006 2013 Autophagy facilitates organelle clearance during differentiation of human erythroblasts: evidence for a role for ATG4 paralogs during autophagosome maturation.
22302004 2012 A high-throughput FRET-based assay for determination of Atg4 activity.
21297227 2010 A systematic bioinformatics approach for selection of target and screening of ligand for malignant tumours suppressing APG4A gene on Xq22.1.
21245471 2011 High-throughput fluorescence assay for small-molecule inhibitors of autophagins/Atg4.
21177865 2011 Kinetics comparisons of mammalian Atg4 homologues indicate selective preferences toward diverse Atg8 substrates.
21122541 2010 Granulomas in Crohn's disease: are newly discovered genetic variants involved?
More...