Property Summary

NCBI Gene PubMed Count 40
Grant Count 18
R01 Count 13
Funding $950,539.32
PubMed Score 25.01
PubTator Score 34.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis 1.500 0.003
psoriasis 1.700 0.000
osteosarcoma 3.632 0.000
astrocytoma 1.200 0.015
lung cancer -1.300 0.003
Multiple Sclerosis -1.100 0.000
lung carcinoma -1.100 0.000
Pick disease 1.500 0.000
gastric carcinoma 1.100 0.006
ovarian cancer 1.800 0.000

Gene RIF (25)

PMID Text
25684665 Results reveal that SSH1L is upregulated in a subset of PCs and that the SSH1L/cofilin-1 signal pathway is associated positively in PC with cell migration.
25100728 The association of IRS4 with SSH1 contributes to localized activation of cofilin in membrane protrusions.
24670325 Authors show that viral penetration-induced calcium release facilitated herpes simplex virus type 1 intracellular trafficking through activating slingshot 1 (SSH), a phosphatase regulating actin filament dynamics.
24418541 Slingshot 1 downregulation in neuronal cells inactivates cofilin to facilitate HSV-1 replication.
24039253 Thus this study provides evidence for a novel role of LIMK1 and SSH-1L in selectively regulating endothelial cell inflammation associated with intravascular coagulation.
23834120 Results identify a novel frameshift mutation in this gene implicated in disseminated superficial actinic porokeratosis in 4 Chinese families
23247370 Our work provides evidence that supports the positive role of SSH1L in the mechanism of stem cell differentiation into cardiomyocyte-like cells.
22282498 EphA signaling promotes actin-based dendritic spine remodeling through slingshot 1.
21690039 A high expression of SSH-1L in peripheral eosinophils in acute exacerbations of asthma may play a role in the activation and migration of eosinophils.
21525957 identified Ser 402 as a new phosphorylation site within the catalytic domain of human slingshot 1 (SSH1).
More...

AA Sequence

MALVTLQRSPTPSAASSSASNSELEAGSEEDRKLNLSLSESFFMVKGAALFLQQGSSPQGQRSLQHPHKH      1 - 70
AGDLPQHLQVMINLLRCEDRIKLAVRLESAWADRVRYMVVVYSSGRQDTEENILLGVDFSSKESKSCTIG     71 - 140
MVLRLWSDTKIHLDGDGGFSVSTAGRMHIFKPVSVQAMWSALQVLHKACEVARRHNYFPGGVALIWATYY    141 - 210
ESCISSEQSCINEWNAMQDLESTRPDSPALFVDKPTEGERTERLIKAKLRSIMMSQDLENVTSKEIRNEL    211 - 280
EKQMNCNLKELKEFIDNEMLLILGQMDKPSLIFDHLYLGSEWNASNLEELQGSGVDYILNVTREIDNFFP    281 - 350
GLFAYHNIRVYDEETTDLLAHWNEAYHFINKAKRNHSKCLVHCKMGVSRSASTVIAYAMKEFGWPLEKAY    351 - 420
NYVKQKRSITRPNAGFMRQLSEYEGILDASKQRHNKLWRQQTDSSLQQPVDDPAGPGDFLPETPDGTPES    421 - 490
QLPFLDDAAQPGLGPPLPCCFRRLSDPLLPSPEDETGSLVHLEDPEREALLEEAAPPAEVHRPARQPQQG    491 - 560
SGLCEKDVKKKLEFGSPKGRSGSLLQVEETEREEGLGAGRWGQLPTQLDQNLLNSENLNNNSKRSCPNGM    561 - 630
EDDAIFGILNKVKPSYKSCADCMYPTASGAPEASRERCEDPNAPAICTQPAFLPHITSSPVAHLASRSRV    631 - 700
PEKPASGPTEPPPFLPPAGSRRADTSGPGAGAALEPPASLLEPSRETPKVLPKSLLLKNSHCDKNPPSTE    701 - 770
VVIKEESSPKKDMKPAKDLRLLFSNESEKPTTNSYLMQHQESIIQLQKAGLVRKHTKELERLKSVPADPA    771 - 840
PPSRDGPASRLEASIPEESQDPAALHELGPLVMPSQAGSDEKSEAAPASLEGGSLKSPPPFFYRLDHTSS    841 - 910
FSKDFLKTICYTPTSSSMSSNLTRSSSSDSIHSVRGKPGLVKQRTQEIETRLRLAGLTVSSPLKRSHSLA    911 - 980
KLGSLTFSTEDLSSEADPSTVADSQDTTLSESSFLHEPQGTPRDPAATSKPSGKPAPENLKSPSWMSKS     981 - 1049
//

Text Mined References (45)

PMID Year Title
25684665 2015 Cofilin-phosphatase slingshot-1L (SSH1L) is over-expressed in pancreatic cancer (PC) and contributes to tumor cell migration.
25100728 2014 Insulin receptor substrate-4 binds to Slingshot-1 phosphatase and promotes cofilin dephosphorylation.
24670325 2014 Calcium-signal facilitates herpes simplex virus type 1 nuclear transport through slingshot 1 and calpain-1 activation.
24418541 2014 Ubiquitin-proteasome-dependent slingshot 1 downregulation in neuronal cells inactivates cofilin to facilitate HSV-1 replication.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24039253 2013 Thrombin selectively engages LIM kinase 1 and slingshot-1L phosphatase to regulate NF-?B activation and endothelial cell inflammation.
23834120 2013 Identification of three novel frameshift mutations of the MVK gene in four Chinese families with disseminated superficial actinic porokeratosis.
23247370 2012 The role of slingshot-1L (SSH1L) in the differentiation of human bone marrow mesenchymal stem cells into cardiomyocyte-like cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22282498 2012 EphA signaling promotes actin-based dendritic spine remodeling through slingshot phosphatase.
More...