Property Summary

NCBI Gene PubMed Count 21
PubMed Score 87.42
PubTator Score 134.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 8.68097533059714E-10
group 4 medulloblastoma 1875 4.24895074186131E-5
interstitial cystitis 2299 0.00463520357794299
Disease Target Count Z-score Confidence
Yaws 8 3.358 1.7
Juvenile absence epilepsy 4 3.158 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -4.448 0.000
interstitial cystitis 1.600 0.005
group 4 medulloblastoma -1.500 0.000

Synonym

Accession Q8WYJ6 B4DVE6 Q658T1 Q8NEZ1 Q96EL4 Q9H285
Symbols LARP
SEP1
DIFF6
PNUTL3

Gene

  Ortholog (8)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (3)

PMID Text
23087102 The SEPT1 may participate in cell-cell and/or cell-substrate interaction in DJM-1 and exert its function in a coordinated manner with other septins.
17912427 An increase in Sept1 expression in all oral squamous-cell carcinoma-derived cell lines compared to human normal oral keratinocytes and oral premalignant lesions suggest that Sept1 expression could contribute to cancer progression, proliferation, or both.
16179162 Aurora-B binds and phosphorylates Septin1.

AA Sequence

MDKEYVGFAALPNQLHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTNLYEDRQVPEASARLTQTLAIE      1 - 70
RRGVEIEEGGVKVKLTLVDTPGFGDSVDCSDCWLPVVKFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYF     71 - 140
ISPFGRGLRPLDVAFLRAVHEKVNIIPVIGKADALMPQETQALKQKIRDQLKEEEIHIYQFPECDSDEDE    141 - 210
DFKRQDAEMKESIPFAVVGSCEVVRDGGNRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEV    211 - 280
THDLLYEGYRARCLQSLARPGARDRASRSKLSRQSATEIPLPMLPLADTEKLIREKDEELRRMQEMLEKM    281 - 350
QAQMQQSQAQGEQSDAL                                                         351 - 367
//

Text Mined References (26)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23087102 2013 Possible role of a septin, SEPT1, in spreading in squamous cell carcinoma DJM-1 cells.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21809895 2011 Septin genomics: a road less travelled.
21269460 2011 Initial characterization of the human central proteome.
21082023 2010 A draft of the human septin interactome.
20236126 2010 Conquering the complex world of human septins: implications for health and disease.
20136629 2009 Structural and expression changes of septins in myeloid neoplasia.
19799413 2009 From midbody protein-protein interaction network construction to novel regulators in cytokinesis.
More...