Property Summary

NCBI Gene PubMed Count 21
Grant Count 14
Funding $3,263,060.3
PubMed Score 87.42
PubTator Score 134.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -4.448 0.000
interstitial cystitis 1.600 0.005
group 4 medulloblastoma -1.500 0.000

Gene RIF (3)

PMID Text
23087102 The SEPT1 may participate in cell-cell and/or cell-substrate interaction in DJM-1 and exert its function in a coordinated manner with other septins.
17912427 An increase in Sept1 expression in all oral squamous-cell carcinoma-derived cell lines compared to human normal oral keratinocytes and oral premalignant lesions suggest that Sept1 expression could contribute to cancer progression, proliferation, or both.
16179162 Aurora-B binds and phosphorylates Septin1.

AA Sequence

MDKEYVGFAALPNQLHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTNLYEDRQVPEASARLTQTLAIE      1 - 70
RRGVEIEEGGVKVKLTLVDTPGFGDSVDCSDCWLPVVKFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYF     71 - 140
ISPFGRGLRPLDVAFLRAVHEKVNIIPVIGKADALMPQETQALKQKIRDQLKEEEIHIYQFPECDSDEDE    141 - 210
DFKRQDAEMKESIPFAVVGSCEVVRDGGNRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEV    211 - 280
THDLLYEGYRARCLQSLARPGARDRASRSKLSRQSATEIPLPMLPLADTEKLIREKDEELRRMQEMLEKM    281 - 350
QAQMQQSQAQGEQSDAL                                                         351 - 367
//

Text Mined References (26)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23087102 2013 Possible role of a septin, SEPT1, in spreading in squamous cell carcinoma DJM-1 cells.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21809895 2011 Septin genomics: a road less travelled.
21269460 2011 Initial characterization of the human central proteome.
21082023 2010 A draft of the human septin interactome.
20236126 2010 Conquering the complex world of human septins: implications for health and disease.
20136629 2009 Structural and expression changes of septins in myeloid neoplasia.
19799413 2009 From midbody protein-protein interaction network construction to novel regulators in cytokinesis.
More...