Property Summary

NCBI Gene PubMed Count 22
PubMed Score 96.14
PubTator Score 134.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 8.7e-10
group 4 medulloblastoma 1855 4.2e-05
interstitial cystitis 2312 4.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Yaws 7 3.355 1.7
Juvenile absence epilepsy 8 3.035 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
group 4 medulloblastoma -1.500 4.2e-05
interstitial cystitis 1.600 4.6e-03
osteosarcoma -4.448 8.7e-10

Gene RIF (3)

AA Sequence

MDKEYVGFAALPNQLHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTNLYEDRQVPEASARLTQTLAIE      1 - 70
RRGVEIEEGGVKVKLTLVDTPGFGDSVDCSDCWLPVVKFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYF     71 - 140
ISPFGRGLRPLDVAFLRAVHEKVNIIPVIGKADALMPQETQALKQKIRDQLKEEEIHIYQFPECDSDEDE    141 - 210
DFKRQDAEMKESIPFAVVGSCEVVRDGGNRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEV    211 - 280
THDLLYEGYRARCLQSLARPGARDRASRSKLSRQSATEIPLPMLPLADTEKLIREKDEELRRMQEMLEKM    281 - 350
QAQMQQSQAQGEQSDAL                                                         351 - 367
//

Text Mined References (27)

PMID Year Title