Property Summary

NCBI Gene PubMed Count 28
PubMed Score 15.87
PubTator Score 21.97

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 3.54501896103943E-5
tuberculosis and treatment for 6 months 686 4.59953351909817E-5
oligodendroglioma 2849 0.0238524175063273
subependymal giant cell astrocytoma 2287 0.0258027525047088
Disease Target Count Z-score Confidence
Klippel-Trenaunay syndrome 15 3.078 1.5


  Differential Expression (4)

Disease log2 FC p
oligodendroglioma 1.100 0.024
osteosarcoma -2.196 0.000
tuberculosis and treatment for 6 months 1.400 0.000
subependymal giant cell astrocytoma -1.238 0.026


Accession Q8WYH8 A8K1P3 Q53NU6 Q57Z54 Q9BS30
Symbols p28ING5




  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG

Gene RIF (17)

26497554 miR-331-3p is upregulated by HBV and promotes proliferation of hepatocellular carcinoma cells though repression of ING5 expression.
25991669 Results showed that ING5 gene expression is inhibited by miR-193a-3p and is instrumental in miR-193a-3p's role in activating BCa chemoresistance.
25980581 Suggest that ING5 expression might be a good marker for gastric carcinogenesis and its subsequent progression by inhibiting proliferation, growth, migration, invasion and metastasis.
25938545 Loss of ING5 expression is associated with lung cancer.
25860957 Identified ING5 as a novel CDK2 substrate. ING5 is phosphorylated at a single site, threonine 152, by cyclin E/CDK2 and cyclin A/CDK2. This site is also phosphorylated in cells in a cell cycle dependent manner, consistent with it being a CDK2 substrate.
23576563 Data indicate that ING5 associates with Tip60 (KAT5) to form a complex with p53.
22384930 ING5 down-regulation promotes bone mesenchymal stem cell proliferation.
21750715 Results indicate that ING5 is a growth suppressor with suppressed expression in AML whose functions depend on its interaction with INCA1.
21193223 Aberrant inhibitor of growth 5 expression may contribute to pathogenesis, growth, and invasion of colorectal carcinomas.
21177815 EBNA3C negatively regulate p53-mediated functions by interacting with ING4 and ING5.

AA Sequence

WFHFACVDLTTKPKGKWFCPRCVQEKRKKK                                            211 - 240

Text Mined References (36)

PMID Year Title
26497554 2015 Upregulated in Hepatitis B virus-associated hepatocellular carcinoma cells, miR-331-3p promotes proliferation of hepatocellular carcinoma cells by targeting ING5.
25991669 2015 The miR-193a-3p-regulated ING5 gene activates the DNA damage response pathway and inhibits multi-chemoresistance in bladder cancer.
25980581 2015 ING5 suppresses proliferation, apoptosis, migration and invasion, and induces autophagy and differentiation of gastric cancer cells: a good marker for carcinogenesis and subsequent progression.
25938545 2015 ING5 inhibits cancer aggressiveness via preventing EMT and is a potential prognostic biomarker for lung cancer.
25860957 2015 ING5 is phosphorylated by CDK2 and controls cell proliferation independently of p53.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23576563 2013 ING5 is a Tip60 cofactor that acetylates p53 in response to DNA damage.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.