Property Summary

NCBI Gene PubMed Count 29
PubMed Score 20.59
PubTator Score 21.97

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
oligodendroglioma 1.100 2.4e-02
osteosarcoma -2.196 3.5e-05
subependymal giant cell astrocytoma -1.238 2.6e-02
tuberculosis and treatment for 6 months 1.400 4.6e-05

Protein-protein Interaction (1)

Gene RIF (18)

AA Sequence

MATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEDKKAEIDILAAEYISTVKTLSPDQRVERLQKIQN      1 - 70
AYSKCKEYSDDKVQLAMQTYEMVDKHIRRLDADLARFEADLKDKMEGSDFESSGGRGLKKGRGQKEKRGS     71 - 140
RGRGRRTSEEDTPKKKKHKGGSEFTDTILSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIE    141 - 210
WFHFACVDLTTKPKGKWFCPRCVQEKRKKK                                            211 - 240
//

Text Mined References (37)

PMID Year Title