Property Summary

NCBI Gene PubMed Count 37
PubMed Score 1532.14
PubTator Score 114.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.100 4.7e-03
lung cancer 1.400 1.6e-04
osteosarcoma -1.541 3.0e-05
ovarian cancer 1.700 1.6e-05

 GO Function (1)

Gene RIF (22)

AA Sequence

MDVGELLSYQPNRGTKRPRDDEEEEQKMRRKQTGTRERGRYREEEMTVVEEADDDKKRLLQIIDRDGEEE      1 - 70
EEEEEPLDESSVKKMILTFEKRSYKNQELRIKFPDNPEKFMESELDLNDIIQEMHVVATMPDLYHLLVEL     71 - 140
NAVQSLLGLLGHDNTDVSIAVVDLLQELTDIDTLHESEEGAEVLIDALVDGQVVALLVQNLERLDESVKE    141 - 210
EADGVHNTLAIVENMAEFRPEMCTEGAQQGLLQWLLKRLKAKMPFDANKLYCSEVLAILLQDNDENRELL    211 - 280
GELDGIDVLLQQLSVFKRHNPSTAEEQEMMENLFDSLCSCLMLSSNRERFLKGEGLQLMNLMLREKKISR    281 - 350
SSALKVLDHAMIGPEGTDNCHKFVDILGLRTIFPLFMKSPRKIKKVGTTEKEHEEHVCSILASLLRNLRG    351 - 420
QQRTRLLNKFTENDSEKVDRLMELHFKYLGAMQVADKKIEGEKHDMVRRGEIIDNDTEEEFYLRRLDAGL    421 - 490
FVLQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENIGDGRSPEFRENEQKRILGLL    491 - 560
ENF                                                                       561 - 563
//

Text Mined References (44)

PMID Year Title