Property Summary

NCBI Gene PubMed Count 35
Grant Count 90
R01 Count 26
Funding $13,330,605.53
PubMed Score 1413.43
PubTator Score 114.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.541 0.000
lung cancer 1.400 0.000
group 3 medulloblastoma 1.100 0.005
ovarian cancer 1.700 0.000

Synonym

Accession Q8WYA6 B4DE16 Q0VAL9 Q0VAM0 Q53HI8 Q5JWZ2 Q5JWZ3 Q5JWZ7 Q5JWZ8 Q8N454 Q8NCL2 Q8TBD6 Q96KD2 Q9H7A5 Q9NQF9 Q9NTX0 Q9Y3M7
Symbols NAP
P14L
PP8304
C20orf33
dJ633O20.1

Gene

PDB

4CB8   4CB9   4CBA   4HM9   4HNM   4MFU   4MFV  

 GO Function (1)

Gene RIF (20)

PMID Text
26130721 The results show that CTNNBL1 enhances the association of CWC15 and CDC5L, both core Prp19 complex proteins and identify an overlap in the region of CDC5L that binds either CTNNBL1 or CWC15 suggesting the two proteins might exchange places in the complex.
25268258 Variants in the gene CTNNBL1 (encoding catenin-beta-like 1, located on chromosome 20 q11.23-q12) have been found to be associated with verbal episodic memory performance.
24598747 The crystal structure of CTNNBL1 shows that the protein coalphansists mainly of alpha-helices and forms an armadillo (ARM) repeat. structure
24269683 Results indicate CTNNBL1 as a unique selective nuclear localization signals (NLSs)-binding protein with striking differences from karyopherin-alphas.
23897482 CTNNBL1 crystal structure provides critical insights into the molecular interactions between CTNNBL1 and its protein partners.
22105620 From this gene expression data and fMRI experiments suggests a role for the beta-catenin-like protein 1 in human episodic memory.
21385873 CTNNBL1 is a novel nuclear localization sequence-binding protein that recognizes RNA-splicing factors CDC5L and Prp31
21215100 There are abnormal expression of beta-catenin and activation of Wnt signaling pathway in human esophageal carcinoma cell line Eca-109.
21055033 There was a significantly positive correlation between LMP1 expression and abnormal expression of beta-catenin in nasopharyngeal carcinoma tissue.
20816195 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MDVGELLSYQPNRGTKRPRDDEEEEQKMRRKQTGTRERGRYREEEMTVVEEADDDKKRLLQIIDRDGEEE      1 - 70
EEEEEPLDESSVKKMILTFEKRSYKNQELRIKFPDNPEKFMESELDLNDIIQEMHVVATMPDLYHLLVEL     71 - 140
NAVQSLLGLLGHDNTDVSIAVVDLLQELTDIDTLHESEEGAEVLIDALVDGQVVALLVQNLERLDESVKE    141 - 210
EADGVHNTLAIVENMAEFRPEMCTEGAQQGLLQWLLKRLKAKMPFDANKLYCSEVLAILLQDNDENRELL    211 - 280
GELDGIDVLLQQLSVFKRHNPSTAEEQEMMENLFDSLCSCLMLSSNRERFLKGEGLQLMNLMLREKKISR    281 - 350
SSALKVLDHAMIGPEGTDNCHKFVDILGLRTIFPLFMKSPRKIKKVGTTEKEHEEHVCSILASLLRNLRG    351 - 420
QQRTRLLNKFTENDSEKVDRLMELHFKYLGAMQVADKKIEGEKHDMVRRGEIIDNDTEEEFYLRRLDAGL    421 - 490
FVLQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENIGDGRSPEFRENEQKRILGLL    491 - 560
ENF                                                                       561 - 563
//

Text Mined References (42)

PMID Year Title
26130721 2015 CTNNBL1 facilitates the association of CWC15 with CDC5L and is required to maintain the abundance of the Prp19 spliceosomal complex.
25416956 2014 A proteome-scale map of the human interactome network.
25268258 2014 No association between CTNNBL1 and episodic memory performance.
24598747 2014 Structural insights into the novel ARM-repeat protein CTNNBL1 and its association with the hPrp19-CDC5L complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24269683 2014 Structural and mutational analysis reveals that CTNNBL1 binds NLSs in a manner distinct from that of its closest armadillo-relative, karyopherin ?.
23897482 2013 The structure of full-length human CTNNBL1 reveals a distinct member of the armadillo-repeat protein family.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
More...