Property Summary

NCBI Gene PubMed Count 29
PubMed Score 123.64
PubTator Score 52.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
active Crohn's disease 1.212 1.8e-02
active ulcerative colitis 1.314 9.0e-03
astrocytic glioma -1.300 1.2e-02
Atopic dermatitis 1.100 9.3e-04
colon cancer 1.800 3.9e-02
ependymoma -1.300 2.5e-02
interstitial cystitis 1.700 4.3e-04
intraductal papillary-mucinous adenoma (... 1.300 6.3e-05
intraductal papillary-mucinous carcinoma... 1.500 3.2e-03
intraductal papillary-mucinous neoplasm ... 1.500 2.2e-03
lung adenocarcinoma 1.100 1.9e-05
lung cancer 1.300 3.6e-02
malignant mesothelioma -1.300 1.5e-05
medulloblastoma -1.300 2.4e-03
medulloblastoma, large-cell -1.400 5.8e-03
non-small cell lung cancer 2.788 4.4e-16
oligodendroglioma -1.100 1.9e-02
ovarian cancer 1.100 2.0e-04
pancreatic cancer 2.100 1.7e-07
primary Sjogren syndrome 1.100 1.2e-03
psoriasis 2.800 6.8e-12
spina bifida -2.401 4.1e-02

Gene RIF (20)

AA Sequence

MAAEEEAAAGGKVLREENQCIAPVVSSRVSPGTRPTAMGSFSSHMTEFPRKRKGSDSDPSQSGIMTEKVV      1 - 70
EKLSQNPLTYLLSTRIEISASSGSRVEDGEHQVKMKAFREAHSQTEKRRRDKMNNLIEELSAMIPQCNPM     71 - 140
ARKLDKLTVLRMAVQHLRSLKGLTNSYVGSNYRPSFLQDNELRHLILKTAEGFLFVVGCERGKILFVSKS    141 - 210
VSKILNYDQASLTGQSLFDFLHPKDVAKVKEQLSSFDISPREKLIDAKTGLQVHSNLHAGRTRVYSGSRR    211 - 280
SFFCRIKSCKISVKEEHGCLPNSKKKEHRKFYTIHCTGYLRSWPPNIVGMEEERNSKKDNSNFTCLVAIG    281 - 350
RLQPYIVPQNSGEINVKPTEFITRFAVNGKFVYVDQRATAILGYLPQELLGTSCYEYFHQDDHNNLTDKH    351 - 420
KAVLQSKEKILTDSYKFRAKDGSFVTLKSQWFSFTNPWTKELEYIVSVNTLVLGHSEPGEASFLPCSSQS    421 - 490
SEESSRQSCMSVPGMSTGTVLGAGSIGTDIANEILDLQRLQSSSYLDDSSPTGLMKDTHTVNCRSMSNKE    491 - 560
LFPPSPSEMGELEATRQNQSTVAVHSHEPLLSDGAQLDFDALCDNDDTAMAAFMNYLEAEGGLGDPGDFS    561 - 630
DIQWTL                                                                    631 - 636
//

Text Mined References (33)

PMID Year Title