Property Summary

NCBI Gene PubMed Count 27
Grant Count 7
R01 Count 6
Funding $2,016,901
PubMed Score 88.57
PubTator Score 52.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
astrocytic glioma -1.400 0.008
ependymoma -1.300 0.025
oligodendroglioma -1.400 0.011
psoriasis 2.800 0.000
medulloblastoma -1.300 0.002
medulloblastoma, large-cell -1.400 0.006
Atopic dermatitis 1.100 0.001
non-small cell lung cancer 2.788 0.000
intraductal papillary-mucinous adenoma (... 1.700 0.003
intraductal papillary-mucinous carcinoma... 2.100 0.004
intraductal papillary-mucinous neoplasm ... 2.200 0.011
lung cancer 2.500 0.000
colon cancer 1.800 0.039
active Crohn's disease 1.769 0.010
ulcerative colitis 2.600 0.000
pancreatic cancer 2.100 0.000
interstitial cystitis 1.700 0.000
lung adenocarcinoma 1.600 0.000
primary Sjogren syndrome 1.100 0.001
spina bifida -2.401 0.041
ovarian cancer 1.100 0.000

Gene RIF (19)

PMID Text
26497775 BMAL2 rs7958822 genotype is associated with type 2 diabetes in obese men and women; an interaction between BMAL2 rs7958822 genotype and obesity was observed in men
24847962 The prevalence of C carriers in BMAL2 gene rs2306074 T/C in Alzheimer disease patients was significantly higher than that of control subjects
24635757 there is significant association between diurnal preference and a polymorphism in PER3 and a novel nominally significant association between diurnal preference and a polymorphism in ARNTL2
22198637 ARNTL2 expression is increased in colorectal cancer and in a highly proliferative colon cancer cell line and is related to tumor invasiveness and aggressiveness.
21658431 results show a difference in the expression pattern of Bmal2, but not Clock and Dec1 in PD.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20554694 Observational study of gene-disease association. (HuGE Navigator)
20368993 Observational study of gene-disease association. (HuGE Navigator)
20180986 Observational study of gene-disease association. (HuGE Navigator)
20174623 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAAEEEAAAGGKVLREENQCIAPVVSSRVSPGTRPTAMGSFSSHMTEFPRKRKGSDSDPSQSGIMTEKVV      1 - 70
EKLSQNPLTYLLSTRIEISASSGSRVEDGEHQVKMKAFREAHSQTEKRRRDKMNNLIEELSAMIPQCNPM     71 - 140
ARKLDKLTVLRMAVQHLRSLKGLTNSYVGSNYRPSFLQDNELRHLILKTAEGFLFVVGCERGKILFVSKS    141 - 210
VSKILNYDQASLTGQSLFDFLHPKDVAKVKEQLSSFDISPREKLIDAKTGLQVHSNLHAGRTRVYSGSRR    211 - 280
SFFCRIKSCKISVKEEHGCLPNSKKKEHRKFYTIHCTGYLRSWPPNIVGMEEERNSKKDNSNFTCLVAIG    281 - 350
RLQPYIVPQNSGEINVKPTEFITRFAVNGKFVYVDQRATAILGYLPQELLGTSCYEYFHQDDHNNLTDKH    351 - 420
KAVLQSKEKILTDSYKFRAKDGSFVTLKSQWFSFTNPWTKELEYIVSVNTLVLGHSEPGEASFLPCSSQS    421 - 490
SEESSRQSCMSVPGMSTGTVLGAGSIGTDIANEILDLQRLQSSSYLDDSSPTGLMKDTHTVNCRSMSNKE    491 - 560
LFPPSPSEMGELEATRQNQSTVAVHSHEPLLSDGAQLDFDALCDNDDTAMAAFMNYLEAEGGLGDPGDFS    561 - 630
DIQWTL                                                                    631 - 636
//

Text Mined References (30)

PMID Year Title
26497775 2015 Association between brain-muscle-ARNT-like protein-2 (BMAL2) gene polymorphism and type 2 diabetes mellitus in obese Japanese individuals: A cross-sectional analysis of the Japan Multi-institutional Collaborative Cohort Study.
24847962 2014 The polymorphism of ARNTL2 (BMAL2) gene rs2306074 C>T is associated with susceptibility of Alzheimer disease in Chinese population.
24635757 2014 Polymorphisms in the circadian expressed genes PER3 and ARNTL2 are associated with diurnal preference and GN?3 with sleep measures.
22198637 2012 ARNTL2 and SERPINE1: potential biomarkers for tumor aggressiveness in colorectal cancer.
21658431 2011 Decreased expression of Bmal2 in patients with Parkinson's disease.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20554694 Circadian clock gene polymorphisms in alcohol use disorders and alcohol consumption.
20368993 2010 ARNTL (BMAL1) and NPAS2 gene variants contribute to fertility and seasonality.
20180986 2010 CLOCK is suggested to associate with comorbid alcohol use and depressive disorders.
20174623 2010 Systematic analysis of circadian genes in a population-based sample reveals association of TIMELESS with depression and sleep disturbance.
More...