Property Summary

NCBI Gene PubMed Count 27
PubMed Score 88.57
PubTator Score 52.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
non-small cell lung cancer 2798 4.40495370838348E-16
psoriasis 6685 6.75960151628233E-12
ulcerative colitis 2087 5.57506506944429E-8
pancreatic cancer 2300 1.69898205108117E-7
malignant mesothelioma 3163 1.52617706920814E-5
lung adenocarcinoma 2714 3.88708036031811E-5
ovarian cancer 8492 2.04175883513169E-4
lung cancer 4473 2.66045317544002E-4
interstitial cystitis 2299 4.2916344890421E-4
Atopic dermatitis 944 9.31123585945814E-4
primary Sjogren syndrome 789 0.00117693766242885
medulloblastoma 1524 0.00242573750025545
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00259572412726612
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0037058157012917
medulloblastoma, large-cell 6234 0.00581962709388805
astrocytic glioma 2241 0.00764670837131099
active Crohn's disease 918 0.0102904948289129
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0107105156670324
oligodendroglioma 2849 0.011268934270089
ependymoma 2514 0.024917428251872
colon cancer 1475 0.039387286885845
spina bifida 1064 0.0410475895921338
Disease Target Count Z-score Confidence
Liver disease 219 4.282 2.1
systemic lupus erythematosus 172 3.34 1.7

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
astrocytic glioma -1.400 0.008
ependymoma -1.300 0.025
oligodendroglioma -1.400 0.011
psoriasis 2.800 0.000
medulloblastoma -1.300 0.002
medulloblastoma, large-cell -1.400 0.006
Atopic dermatitis 1.100 0.001
non-small cell lung cancer 2.788 0.000
intraductal papillary-mucinous adenoma (... 1.700 0.003
intraductal papillary-mucinous carcinoma... 2.100 0.004
intraductal papillary-mucinous neoplasm ... 2.200 0.011
lung cancer 2.500 0.000
colon cancer 1.800 0.039
active Crohn's disease 1.769 0.010
ulcerative colitis 2.600 0.000
pancreatic cancer 2.100 0.000
interstitial cystitis 1.700 0.000
lung adenocarcinoma 1.600 0.000
primary Sjogren syndrome 1.100 0.001
spina bifida -2.401 0.041
ovarian cancer 1.100 0.000

Synonym

Accession Q8WYA1 B7Z429 F5H402 Q8WYA2 Q8WYA3 Q8WYA4 Q96J63 Q9H2M4 Q9NS70 Q9NYQ4 Q9NYQ5
Symbols CLIF
MOP9
BMAL2
PASD9
bHLHe6

Gene

PDB

2KDK  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (19)

PMID Text
26497775 BMAL2 rs7958822 genotype is associated with type 2 diabetes in obese men and women; an interaction between BMAL2 rs7958822 genotype and obesity was observed in men
24847962 The prevalence of C carriers in BMAL2 gene rs2306074 T/C in Alzheimer disease patients was significantly higher than that of control subjects
24635757 there is significant association between diurnal preference and a polymorphism in PER3 and a novel nominally significant association between diurnal preference and a polymorphism in ARNTL2
22198637 ARNTL2 expression is increased in colorectal cancer and in a highly proliferative colon cancer cell line and is related to tumor invasiveness and aggressiveness.
21658431 results show a difference in the expression pattern of Bmal2, but not Clock and Dec1 in PD.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20554694 Observational study of gene-disease association. (HuGE Navigator)
20368993 Observational study of gene-disease association. (HuGE Navigator)
20180986 Observational study of gene-disease association. (HuGE Navigator)
20174623 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAAEEEAAAGGKVLREENQCIAPVVSSRVSPGTRPTAMGSFSSHMTEFPRKRKGSDSDPSQSGIMTEKVV      1 - 70
EKLSQNPLTYLLSTRIEISASSGSRVEDGEHQVKMKAFREAHSQTEKRRRDKMNNLIEELSAMIPQCNPM     71 - 140
ARKLDKLTVLRMAVQHLRSLKGLTNSYVGSNYRPSFLQDNELRHLILKTAEGFLFVVGCERGKILFVSKS    141 - 210
VSKILNYDQASLTGQSLFDFLHPKDVAKVKEQLSSFDISPREKLIDAKTGLQVHSNLHAGRTRVYSGSRR    211 - 280
SFFCRIKSCKISVKEEHGCLPNSKKKEHRKFYTIHCTGYLRSWPPNIVGMEEERNSKKDNSNFTCLVAIG    281 - 350
RLQPYIVPQNSGEINVKPTEFITRFAVNGKFVYVDQRATAILGYLPQELLGTSCYEYFHQDDHNNLTDKH    351 - 420
KAVLQSKEKILTDSYKFRAKDGSFVTLKSQWFSFTNPWTKELEYIVSVNTLVLGHSEPGEASFLPCSSQS    421 - 490
SEESSRQSCMSVPGMSTGTVLGAGSIGTDIANEILDLQRLQSSSYLDDSSPTGLMKDTHTVNCRSMSNKE    491 - 560
LFPPSPSEMGELEATRQNQSTVAVHSHEPLLSDGAQLDFDALCDNDDTAMAAFMNYLEAEGGLGDPGDFS    561 - 630
DIQWTL                                                                    631 - 636
//

Text Mined References (30)

PMID Year Title
26497775 2015 Association between brain-muscle-ARNT-like protein-2 (BMAL2) gene polymorphism and type 2 diabetes mellitus in obese Japanese individuals: A cross-sectional analysis of the Japan Multi-institutional Collaborative Cohort Study.
24847962 2014 The polymorphism of ARNTL2 (BMAL2) gene rs2306074 C>T is associated with susceptibility of Alzheimer disease in Chinese population.
24635757 2014 Polymorphisms in the circadian expressed genes PER3 and ARNTL2 are associated with diurnal preference and GN?3 with sleep measures.
22198637 2012 ARNTL2 and SERPINE1: potential biomarkers for tumor aggressiveness in colorectal cancer.
21658431 2011 Decreased expression of Bmal2 in patients with Parkinson's disease.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20554694 Circadian clock gene polymorphisms in alcohol use disorders and alcohol consumption.
20368993 2010 ARNTL (BMAL1) and NPAS2 gene variants contribute to fertility and seasonality.
20180986 2010 CLOCK is suggested to associate with comorbid alcohol use and depressive disorders.
20174623 2010 Systematic analysis of circadian genes in a population-based sample reveals association of TIMELESS with depression and sleep disturbance.
More...