Property Summary

NCBI Gene PubMed Count 14
PubMed Score 108.79
PubTator Score 22.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
acute myeloid leukemia -1.100 2.8e-02
atypical teratoid / rhabdoid tumor 1.400 2.1e-06
diabetes mellitus -1.200 1.0e-03
ependymoma 2.100 2.2e-02
glioblastoma 1.400 1.7e-07
group 3 medulloblastoma 1.800 3.6e-05
lung cancer 1.500 8.8e-04
malignant mesothelioma -1.100 3.2e-05
pediatric high grade glioma 1.300 9.8e-06
primitive neuroectodermal tumor 1.600 4.8e-06

Protein-protein Interaction (7)

Gene RIF (3)

AA Sequence

MSDQIKFIMDSLNKEPFRKNYNLITFDSLEPMQLLQVLSDVLAEIDPKQLVDIREEMPEQTAKRMLSLLG      1 - 70
ILKYKPSGNATDMSTFRQGLVIGSKPVIYPVLHWLLQRTNELKKRAYLARFLIKLEVPSEFLQDETVADT     71 - 140
NKQYEELMEAFKTLHKEYEQLKISGFSTAEIRKDISAMEEEKDQLIKRVEHLKKRVETAQNHQWMLKIAR    141 - 210
QLRVEKEREEYLAQQKQEQKNQLFHAVQRLQRVQNQLKSMRQAAADAKPESLMKRLEEEIKFNLYMVTEK    211 - 280
FPKELENKKKELHFLQKVVSEPAMGHSDLLELESKINEINTEINQLIEKKMMRNEPIEGKLSLYRQQASI    281 - 350
ISRKKEAKAEELQEAKEKLASLEREASVKRNQTREFDGTEVLKGDEFKRYVNKLRSKSTVFKKKHQIIAE    351 - 420
LKAEFGLLQRTEELLKQRHENIQQQLQTMEEKKGISGYSYTQEELERVSALKSEVDEMKGRTLDDMSEMV    421 - 490
KKLYSLVSEKKSALASVIKELRQLRQKYQELTQECDEKKSQYDSCAAGLESNRSKLEQEVRRLREECLQE    491 - 560
ESRYHYTNCMIKNLEVQLRRATDEMKAYISSDQQEKRKAIREQYTKNTAEQENLGKKLREKQKVIRESHG    561 - 630
PNMKQAKMWRDLEQLMECKKQCFLKQQSQTSIGQVIQEGGEDRLIL                            631 - 676
//

Text Mined References (18)

PMID Year Title