Property Summary

NCBI Gene PubMed Count 8
Grant Count 16
R01 Count 16
Funding $2,266,790.2
PubMed Score 98.17
PubTator Score 22.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

 GO Function (1)

Gene RIF (2)

PMID Text
23990561 this study found that the two core intraflagellar transport proteins IFT74 and IFT81 form a tubulin-binding module and mapped the interaction to a calponin homology domain of IFT81 and a highly basic domain in IFT74.
12549821 inconsistent expression levels of human CDV-1 and mouse Cdv-1 in heart implied that cardiac hypertrophy in human SCD might not be associated with the abnormal expression of CDV-1

AA Sequence

MSDQIKFIMDSLNKEPFRKNYNLITFDSLEPMQLLQVLSDVLAEIDPKQLVDIREEMPEQTAKRMLSLLG      1 - 70
ILKYKPSGNATDMSTFRQGLVIGSKPVIYPVLHWLLQRTNELKKRAYLARFLIKLEVPSEFLQDETVADT     71 - 140
NKQYEELMEAFKTLHKEYEQLKISGFSTAEIRKDISAMEEEKDQLIKRVEHLKKRVETAQNHQWMLKIAR    141 - 210
QLRVEKEREEYLAQQKQEQKNQLFHAVQRLQRVQNQLKSMRQAAADAKPESLMKRLEEEIKFNLYMVTEK    211 - 280
FPKELENKKKELHFLQKVVSEPAMGHSDLLELESKINEINTEINQLIEKKMMRNEPIEGKLSLYRQQASI    281 - 350
ISRKKEAKAEELQEAKEKLASLEREASVKRNQTREFDGTEVLKGDEFKRYVNKLRSKSTVFKKKHQIIAE    351 - 420
LKAEFGLLQRTEELLKQRHENIQQQLQTMEEKKGISGYSYTQEELERVSALKSEVDEMKGRTLDDMSEMV    421 - 490
KKLYSLVSEKKSALASVIKELRQLRQKYQELTQECDEKKSQYDSCAAGLESNRSKLEQEVRRLREECLQE    491 - 560
ESRYHYTNCMIKNLEVQLRRATDEMKAYISSDQQEKRKAIREQYTKNTAEQENLGKKLREKQKVIRESHG    561 - 630
PNMKQAKMWRDLEQLMECKKQCFLKQQSQTSIGQVIQEGGEDRLIL                            631 - 676
//

Text Mined References (12)

PMID Year Title
23990561 2013 Molecular basis of tubulin transport within the cilium by IFT74 and IFT81.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
18088087 2008 Phosphoproteome of resting human platelets.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15955805 2005 Characterization of the intraflagellar transport complex B core: direct interaction of the IFT81 and IFT74/72 subunits.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12549821 2002 Identification of human CDV-1R and mouse Cdv-1R, two novel proteins with putative signal peptides, especially highly expressed in testis and increased with the male sex maturation.
More...