Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 2.9e-05

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.226 2.9e-05

Synonym

Accession Q8WY98 B2R535 D3DPP7 Q6UWY9 Q8N2H6 Q9BSR2 Q9NU76
Symbols AASL548
C1orf91
PRO1105
RP4-622L5
dJ622L5.7

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

AA Sequence

MAASLGQVLALVLVAALWGGTQPLLKRASAGLQRVHEPTWAQQLLQEMKTLFLNTEYLMPFLLNQCGSLL      1 - 70
YYLTLASTDLTLAVPICNSLAIIFTLIVGKALGEDIGGKRAVAGMVLTVIGISLCITSSVPWTAELQLHG     71 - 140
KGQLQTLSQKCKREASGTQSERFG                                                  141 - 164
//

Text Mined References (8)

PMID Year Title