Property Summary

NCBI Gene PubMed Count 40
Grant Count 26
R01 Count 11
Funding $4,555,504.08
PubMed Score 109.06
PubTator Score 167.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
pancreatic cancer -1.200 0.010
malignant mesothelioma 1.500 0.000
osteosarcoma 1.939 0.000
group 4 medulloblastoma -1.800 0.000
atypical teratoid/rhabdoid tumor -1.700 0.000
medulloblastoma, large-cell -1.300 0.026
adrenocortical carcinoma -1.166 0.024
tuberculosis and treatment for 6 months 1.100 0.000
adult high grade glioma -1.100 0.003
pancreatic carcinoma -1.200 0.010
lung adenocarcinoma -1.200 0.000
acute myeloid leukemia 1.200 0.005
ulcerative colitis -1.100 0.000
ovarian cancer 1.200 0.009

Gene RIF (26)

PMID Text
26719329 Data suggest inducible expression of IDOL is subject to robust, rapid regulation by process that is sensitive to deubiquitinase inhibition in human/mouse cell lines and primary human cells; transcriptional induction of IDOL leads to degradation of LDLR.
26666640 Identify USP2 as a novel regulator of lipoprotein clearance owing to its ability to control ubiquitylation-dependent degradation of the LDLR by IDOL.
26601593 Specifically, loss of IDOL increases LDLR distribution in the hepatic cell, and subsequently reduces serum LDL-C levels in dyslipidemic patients
26527619 The study identified MARCH6 as a negative regulator of SREBP2-mediated transcription and described an unexpected E3 circuit functionally linking MARCH6 and IDOL to limit uptake of low-density lipoprotein via the LDLR pathway.
25927920 IDOL N342S Variant, Atherosclerosis Progression and Cardiovascular Disorders in the Italian General Population.
25171759 study indicates that MYLIP p.N342S might be a pharmacogenetic marker for lipid-lowering therapy in patients with FH.
24935961 Liver-specific expression of dominant-active IDOL is associated with hypercholesterolemia and a marked elevation in atherosclerotic lesions in transgenic mice.
23733886 evidence for the existence of an LXR-IDOL-mediated internalization pathway for the LDLR that is distinct from that used for lipoprotein uptake
23382078 IDOL is recruited to plasma membrane by low-density lipoprotein receptor (LDLR), promotes LDLR internalization in the absence of clathrin or caveolae, and facilitates LDLR degradation by shuttling it into the multivesicular body protein-sorting pathway
23324548 Results show that IDOL contributes to variation in circulating levels of LDL-C.
More...

AA Sequence

MLCYVTRPDAVLMEVEVEAKANGEDCLNQVCRRLGIIEVDYFGLQFTGSKGESLWLNLRNRISQQMDGLA      1 - 70
PYRLKLRVKFFVEPHLILQEQTRHIFFLHIKEALLAGHLLCSPEQAVELSALLAQTKFGDYNQNTAKYNY     71 - 140
EELCAKELSSATLNSIVAKHKELEGTSQASAEYQVLQIVSAMENYGIEWHSVRDSEGQKLLIGVGPEGIS    141 - 210
ICKDDFSPINRIAYPVVQMATQSGKNVYLTVTKESGNSIVLLFKMISTRAASGLYRAITETHAFYRCDTV    211 - 280
TSAVMMQYSRDLKGHLASLFLNENINLGKKYVFDIKRTSKEVYDHARRALYNAGVVDLVSRNNQSPSHSP    281 - 350
LKSSESSMNCSSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCESCAAQLQSCPV    351 - 420
CRSRVEHVQHVYLPTHTSLLNLTVI                                                 421 - 445
//

Publication (43)

PMID Year Title
26719329 2016 Deubiquitylase Inhibition Reveals Liver X Receptor-independent Transcriptional Regulation of the E3 Ubiquitin Ligase IDOL and Lipoprotein Uptake.
26666640 2016 The Deubiquitylase USP2 Regulates the LDLR Pathway by Counteracting the E3-Ubiquitin Ligase IDOL.
26601593 2016 IDOL, inducible degrader of low-density lipoprotein receptor, serves as a potential therapeutic target for dyslipidemia.
26527619 2015 A MARCH6 and IDOL E3 Ubiquitin Ligase Circuit Uncouples Cholesterol Synthesis from Lipoprotein Uptake in Hepatocytes.
25927920 2015 IDOL N342S Variant, Atherosclerosis Progression and Cardiovascular Disorders in the Italian General Population.
25416956 2014 A proteome-scale map of the human interactome network.
25171759 2014 The MYLIP p.N342S polymorphism is associated with response to lipid-lowering therapy in Brazilian patients with familial hypercholesterolemia.
24935961 2014 Transgenic expression of dominant-active IDOL in liver causes diet-induced hypercholesterolemia and atherosclerosis in mice.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23733886 2013 The LXR-IDOL axis defines a clathrin-, caveolae-, and dynamin-independent endocytic route for LDLR internalization and lysosomal degradation.
More...