Property Summary

NCBI Gene PubMed Count 42
PubMed Score 115.59
PubTator Score 167.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia 1.200 5.4e-03
adrenocortical carcinoma -1.089 5.9e-03
adult high grade glioma -1.100 3.1e-03
atypical teratoid / rhabdoid tumor -1.200 3.6e-06
group 4 medulloblastoma -1.300 4.5e-06
lung adenocarcinoma -1.200 2.7e-06
malignant mesothelioma 1.500 7.9e-06
medulloblastoma, large-cell -1.300 2.6e-02
osteosarcoma 1.724 2.1e-04
ovarian cancer 1.200 9.4e-03
pancreatic cancer -1.200 1.0e-02
pancreatic carcinoma -1.200 1.0e-02
tuberculosis and treatment for 6 months 1.100 1.6e-04
ulcerative colitis -1.100 1.7e-04

Protein-protein Interaction (5)

Gene RIF (28)

AA Sequence

MLCYVTRPDAVLMEVEVEAKANGEDCLNQVCRRLGIIEVDYFGLQFTGSKGESLWLNLRNRISQQMDGLA      1 - 70
PYRLKLRVKFFVEPHLILQEQTRHIFFLHIKEALLAGHLLCSPEQAVELSALLAQTKFGDYNQNTAKYNY     71 - 140
EELCAKELSSATLNSIVAKHKELEGTSQASAEYQVLQIVSAMENYGIEWHSVRDSEGQKLLIGVGPEGIS    141 - 210
ICKDDFSPINRIAYPVVQMATQSGKNVYLTVTKESGNSIVLLFKMISTRAASGLYRAITETHAFYRCDTV    211 - 280
TSAVMMQYSRDLKGHLASLFLNENINLGKKYVFDIKRTSKEVYDHARRALYNAGVVDLVSRNNQSPSHSP    281 - 350
LKSSESSMNCSSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCESCAAQLQSCPV    351 - 420
CRSRVEHVQHVYLPTHTSLLNLTVI                                                 421 - 445
//

Text Mined References (45)

PMID Year Title