Property Summary

NCBI Gene PubMed Count 12
PubMed Score 9.49
PubTator Score 5.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -2.000 8.5e-05
Alzheimer's disease -1.300 2.6e-02
astrocytic glioma -1.700 1.7e-02
Astrocytoma, Pilocytic -1.200 4.2e-04
atypical teratoid / rhabdoid tumor -1.100 8.7e-03
chronic rhinosinusitis -1.047 3.5e-02
cystic fibrosis and chronic rhinosinusit... -1.182 4.2e-02
ependymoma -1.600 4.2e-07
gastric carcinoma -1.100 4.3e-02
glioblastoma -1.600 1.5e-05
group 4 medulloblastoma 1.600 1.2e-03
juvenile dermatomyositis 1.050 1.1e-04
lung carcinoma 2.000 1.5e-32
ovarian cancer -1.800 8.0e-09
Pick disease -1.500 2.9e-04

Gene RIF (2)

AA Sequence

MAGCIPEEKTYRRFLELFLGEFRGPCGGGEPEPEPEPEPEPEPESEPEPEPELVEAEAAEASVEEPGEEA      1 - 70
ATVAATEEGDQEQDPEPEEEAAVEGEEEEEGAATAAAAPGHSAVPPPPPQLPPLPPLPRPLSERITPRPL     71 - 140
SERITREEVEGESLDLCLQQLYKYNCPSFLAAALARATSDEVLQSDLSAHYIPKETDGTEGTVEIETVKL    141 - 210
ARSVFSKLHEICCSWVKDFPLRRRPQLYYETSIHAIKNMRRKMEDKHVCIPDFNMLFNLEDQEEQAYFAV    211 - 280
FDGHGGVDAAIYASIHLHVNLVRQEMFPHDPAEALCRAFRVTDERFVQKAARESLRCGTTGVVTFIRGNM    281 - 350
LHVAWVGDSQVMLVRKGQAVELMKPHKPDREDEKQRIEALGGCVVWFGAWRVNGSLSVSRAIGDAEHKPY    351 - 420
ICGDADSASTVLDGTEDYLILACDGFYDTVNPDEAVKVVSDHLKENNGDSSMVAHKLVASARDAGSSDNI    421 - 490
TVIVVFLRDMNKAVNVSEESDWTENSFQGGQEDGGDDKENHGECKRPWPQHQCSAPADLGYDGRVDSFTD    491 - 560
RTSLSPGSQINVLEDPGYLDLTQIEASKPHSAQFLLPVEMFGPGAPKKANLINELMMEKKSVQSSLPEWS    561 - 630
GAGEFPTAFNLGSTGEQIYRMQSLSPVCSGLENEQFKSPGNRVSRLSHLRHHYSKKWHRFRFNPKFYSFL    631 - 700
SAQEPSHKIGTSLSSLTGSGKRNRIRSSLPWRQNSWKGYSENMRKLRKTHDIPCPDLPWSYKIE          701 - 764
//

Text Mined References (18)

PMID Year Title