Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.51
PubTator Score 5.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.700 0.017
glioblastoma -2.700 0.001
posterior fossa group A ependymoma -1.700 0.000
atypical teratoid / rhabdoid tumor -3.400 0.000
juvenile dermatomyositis 1.050 0.000
pediatric high grade glioma -2.200 0.000
group 4 medulloblastoma 1.600 0.001
pilocytic astrocytoma -2.300 0.000
lung carcinoma 2.000 0.000
Alzheimer's disease -1.300 0.026
Pick disease -1.500 0.000
gastric carcinoma -1.100 0.043
ovarian cancer -1.800 0.000
chronic rhinosinusitis -1.047 0.035
cystic fibrosis and chronic rhinosinusit... -1.182 0.042

Synonym

Accession Q8WY54 Q68DW1 Q7LAF3 Q9UPT0
Symbols POPX1
PP2CH
caMKN
CaMKP-N

Gene

Gene RIF (2)

PMID Text
20801214 The Ppm1E contributes to dephosphorylation of AMP-activated protein kinase.
11864573 The p21-activated kinase PAK is negatively regulated by POPX1 and POPX2, a pair of serine/threonine phosphatases of the PP2C family. (POPX1; POPX2)

AA Sequence

MAGCIPEEKTYRRFLELFLGEFRGPCGGGEPEPEPEPEPEPEPESEPEPEPELVEAEAAEASVEEPGEEA      1 - 70
ATVAATEEGDQEQDPEPEEEAAVEGEEEEEGAATAAAAPGHSAVPPPPPQLPPLPPLPRPLSERITPRPL     71 - 140
SERITREEVEGESLDLCLQQLYKYNCPSFLAAALARATSDEVLQSDLSAHYIPKETDGTEGTVEIETVKL    141 - 210
ARSVFSKLHEICCSWVKDFPLRRRPQLYYETSIHAIKNMRRKMEDKHVCIPDFNMLFNLEDQEEQAYFAV    211 - 280
FDGHGGVDAAIYASIHLHVNLVRQEMFPHDPAEALCRAFRVTDERFVQKAARESLRCGTTGVVTFIRGNM    281 - 350
LHVAWVGDSQVMLVRKGQAVELMKPHKPDREDEKQRIEALGGCVVWFGAWRVNGSLSVSRAIGDAEHKPY    351 - 420
ICGDADSASTVLDGTEDYLILACDGFYDTVNPDEAVKVVSDHLKENNGDSSMVAHKLVASARDAGSSDNI    421 - 490
TVIVVFLRDMNKAVNVSEESDWTENSFQGGQEDGGDDKENHGECKRPWPQHQCSAPADLGYDGRVDSFTD    491 - 560
RTSLSPGSQINVLEDPGYLDLTQIEASKPHSAQFLLPVEMFGPGAPKKANLINELMMEKKSVQSSLPEWS    561 - 630
GAGEFPTAFNLGSTGEQIYRMQSLSPVCSGLENEQFKSPGNRVSRLSHLRHHYSKKWHRFRFNPKFYSFL    631 - 700
SAQEPSHKIGTSLSSLTGSGKRNRIRSSLPWRQNSWKGYSENMRKLRKTHDIPCPDLPWSYKIE          701 - 764
//

Publication (18)

PMID Year Title
23666239 2013 Meta-analysis identifies four new loci associated with testicular germ cell tumor.
23620142 2013 Genome-wide and gene-centric analyses of circulating myeloperoxidase levels in the charge and care consortia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20801214 2011 Ppm1E is an in cellulo AMP-activated protein kinase phosphatase.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17903297 2007 Genetic correlates of brain aging on MRI and cognitive test measures: a genome-wide association and linkage analysis in the Framingham Study.
17897624 2007 Inhibitors of the Ca(2+)/calmodulin-dependent protein kinase phosphatase family (CaMKP and CaMKP-N).
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
More...