Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q8WY50
Symbols PRED78
C21orf115

Gene

 Compartment GO Term (0)

Gene RIF (5)

PMID Text
24214739 For samples with heterozygous SNPs, PLAC4 RNA-SNP allelic ratio can be used for noninvasive prenatal detection of trisomy 21 by the multiplex SNaPshot assay. In Southeast China, PLAC4 Rs8130833 and Rs4818219 had higher frequency of heterozygosity.
23312075 PLAC4 is upregulated in severe early onset preeclampsia and upregulated with syncytialisation but not hypoxia.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19892844 For prenatal screening of trisomy 21, the quantification of the total PLAC4 mRNA concentration can be used in a synergistic manner with the RNA-SNP allelic ratio approach

AA Sequence

MKELLRLKHCKHLLTTHVHSPWTPSLTLTPSLLTLDTLTHPRHRHSSPWTPHSAPWTPSLTLDTFTHPDT      1 - 70
LTHPGHPHSPWIPSLLTLDTLTHPGYPHSSPWTLSLTLTPSILTLDSLTPHPGLPHSSPWTPSLLILDTL     71 - 140
TQPGHPHSSP                                                                141 - 150
//

Text Mined References (12)

PMID Year Title
26217595 2015 Explore the dynamic alternation of gene PLAC4 mRNA expression levels in maternal plasma in second trimester for nonivasive detection of trisomy 21.
24214739 2014 Application of multiplex SNaPshot assay in measurement of PLAC4 RNA-SNP allelic ratio for noninvasive prenatal detection of trisomy 21.
23903356 2013 Identification of HKDC1 and BACE2 as genes influencing glycemic traits during pregnancy through genome-wide association studies.
23312075 2013 PLAC4 is upregulated in severe early onset preeclampsia and upregulated with syncytialisation but not hypoxia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19892844 2010 Synergy of total PLAC4 RNA concentration and measurement of the RNA single-nucleotide polymorphism allelic ratio for the noninvasive prenatal detection of trisomy 21.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...