Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Synonym

Accession Q8WY50
Symbols PRED78
C21orf115

Gene

 Compartment GO Term (0)

Gene RIF (5)

AA Sequence

MKELLRLKHCKHLLTTHVHSPWTPSLTLTPSLLTLDTLTHPRHRHSSPWTPHSAPWTPSLTLDTFTHPDT      1 - 70
LTHPGHPHSPWIPSLLTLDTLTHPGYPHSSPWTLSLTLTPSILTLDSLTPHPGLPHSSPWTPSLLILDTL     71 - 140
TQPGHPHSSP                                                                141 - 150
//

Text Mined References (12)

PMID Year Title