Property Summary

NCBI Gene PubMed Count 12
Grant Count 5
R01 Count 1
Funding $215,161.08
PubMed Score 22.72
PubTator Score 7.78

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8WY41 NOS-1
Symbols NOS1
NOS-1
SPGF12
EC_Rep1a
ZC2HC12A

Gene

PANTHER Protein Class (2)

PDB

4CQO  

Gene RIF (7)

PMID Text
25100735 High NANOS expression is associated with retinoblastoma.
23320086 Single nucleotide polymorphisms in CYP26B1, NANOS1 and STRA8 genes support involvement of meiotic program initiation in modifying azoospermia and oligozoospermia risk in a Han-Chinese population
23315541 A group of 195 patients manifesting non-obstructive azoospermia or oligozoospermia were tested for mutations of the NANOS1 gene.
21800163 NANOS1-PUMILIO2 complex, together with GEMIN3 and small noncoding RNAs, possibly regulate mRNA translation within the chromatoid body of the human germ cells.
19168546 Data demonstrated that SNAPIN interacts additionally with NANOS1 protein. This is the first report demonstrating that the N-terminal region of NANOS1 is necessary for protein binding.
18223680 The E-cadherin-repressed hNanos1 gene induces tumor cell invasion by upregulating MT1-MMP expression.
17047063 Findings describe a new function for hNanos1 as a downstream effector of E-cadherin loss contributing to tumor progression.

AA Sequence

MEAFPWAPRSPRRGRAPPPMALVPSARYVSAPGPAHPQPFSSWNDYLGLATLITKAVDGEPRFGCARGGN      1 - 70
GGGGSPPSSSSSSCCSPHTGAGPGALGPALGPPDYDEDDDDDSDEPGSRGRYLGSALELRALELCAGPAE     71 - 140
AGLLEERFAELSPFAGRAAAVLLGCAPAAAAAATTTSEATPREERAPAWAAEPRLHAASGAAAARLLKPE    141 - 210
LQVCVFCRNNKEAMALYTTHILKGPDGRVLCPVLRRYTCPLCGASGDNAHTIKYCPLSKVPPPPARPPPR    211 - 280
SARDGPPGKKLR                                                              281 - 292
//

Text Mined References (13)

PMID Year Title
25100735 2014 Post-transcriptional gene expression control by NANOS is up-regulated and functionally important in pRb-deficient cells.
24736845 2014 Structural basis for the Nanos-mediated recruitment of the CCR4-NOT complex and translational repression.
23320086 2013 Genetic variants in meiotic program initiation pathway genes are associated with spermatogenic impairment in a Han Chinese population.
23315541 2013 Mutations of NANOS1, a human homologue of the Drosophila morphogen, are associated with a lack of germ cells in testes or severe oligo-astheno-teratozoospermia.
21800163 2011 NANOS1 and PUMILIO2 bind microRNA biogenesis factor GEMIN3, within chromatoid body in human germ cells.
21421998 2011 NANOS3 function in human germ cell development.
19168546 2009 The SNARE-associated component SNAPIN binds PUMILIO2 and NANOS1 proteins in human male germ cells.
18223680 2008 The E-cadherin-repressed hNanos1 gene induces tumor cell invasion by upregulating MT1-MMP expression.
17047063 2006 E-cadherin regulates human Nanos1, which interacts with p120ctn and induces tumor cell migration and invasion.
16573738 2006 Time-lapse analysis reveals different modes of primordial germ cell migration in the medaka Oryzias latipes.
More...