Property Summary

NCBI Gene PubMed Count 12
PubMed Score 23.72
PubTator Score 7.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Gene RIF (7)

AA Sequence

MEAFPWAPRSPRRGRAPPPMALVPSARYVSAPGPAHPQPFSSWNDYLGLATLITKAVDGEPRFGCARGGN      1 - 70
GGGGSPPSSSSSSCCSPHTGAGPGALGPALGPPDYDEDDDDDSDEPGSRGRYLGSALELRALELCAGPAE     71 - 140
AGLLEERFAELSPFAGRAAAVLLGCAPAAAAAATTTSEATPREERAPAWAAEPRLHAASGAAAARLLKPE    141 - 210
LQVCVFCRNNKEAMALYTTHILKGPDGRVLCPVLRRYTCPLCGASGDNAHTIKYCPLSKVPPPPARPPPR    211 - 280
SARDGPPGKKLR                                                              281 - 292
//

Text Mined References (13)

PMID Year Title