Property Summary

NCBI Gene PubMed Count 12
PubMed Score 35.34
PubTator Score 11.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute quadriplegic myopathy 1.571 1.3e-05
adult high grade glioma 1.200 1.2e-02
Amyotrophic lateral sclerosis 1.202 1.6e-05
astrocytoma 1.400 9.6e-03
Crohn's disease -1.066 7.0e-04
dermatomyositis 1.100 1.8e-03
Down syndrome 1.200 3.2e-03
ependymoma 1.100 1.7e-04
glioblastoma 1.600 3.6e-05
group 4 medulloblastoma -1.300 2.9e-02
juvenile dermatomyositis 1.199 1.1e-09
medulloblastoma, large-cell -1.200 8.9e-03
osteosarcoma 2.763 1.5e-09
ovarian cancer -1.100 1.3e-05
pancreatic ductal adenocarcinoma liver m... 1.500 4.7e-03
Pick disease 2.000 5.2e-05
psoriasis 1.900 1.3e-04
Rheumatoid arthritis 1.300 1.1e-02
ulcerative colitis -1.204 1.4e-02

Gene RIF (1)

AA Sequence

MKGSNRNKDHSAEGEGVGKRPKRKCLQWHPLLAKKLLDFSEEEEEEDEEEDIDKVQLLGADGLEQDVGET      1 - 70
EDDESPEQRARRPMNAFLLFCKRHRSLVRQEHPRLDNRGATKILADWWAVLDPKEKQKYTDMAKEYKDAF     71 - 140
MKANPGYKWCPTTNKPVKSPTPTVNPRKKLWAFPSDSSRDLPSPKKAKTEEMPQLNFGMADPTQMGGLSM    141 - 210
LLLAGEHALGTPEVSSGTCRPDVSESPELRQKSPLFQFAEISSSTSHSDASTKQCQTSALFQFAEISSNT    211 - 280
SQLGGAEPVKRCGKSALFQLAEMCLASEGMKMEESKLIKAKESDGGRIKELEKGKEEKEIKMEKTDETRL    281 - 350
QKEAEFEKSAKENLRDSKELRNFEALQIDDIMAIKMEDPKEIRKEELEEDHKCSHFPDFSYSASSKIIIS    351 - 420
DVPSRKDHMCHPHGIMIIEDPAALNKPEKLKKKKKKSKMDRHGNDKSTPKKTCKKRQSSESDIESVIYTI    421 - 490
EAVAKGDWGIEKLGDTPRKKVRTSSSGKGSILDAKPPKKKVKSREKKMSKEKSSDTTKESRPPDFISISA    491 - 560
SKNISGETPEGIKAEPLTPMEDALPPSLSGQAKPEDSDCHRKIETCGSRKSERSCKGALYKTLVSEGMLT    561 - 630
SLRANVDRGKRSSGKGNSSDHEGCWNEESWTFSQSGTSGSKKFKKTKPKEDCLLGSAKLDEEFEKKFNSL    631 - 700
PQYSPVTFDRKCVPVPRKKKKTGNVSSEPTKTSKGPFQSQKKNLFHKIVSKYKHKKEKPNVPEKGSGDKW    701 - 770
SNKQLFLDAIHPTEAIFSEDRNTMEPVHKVKNIPSIFNTPEPTTTQEPLVGSQKRKARKTKITHLVRTAD    771 - 840
GRVSPAGGTLDDKPKEQLQRSLPKATETDCNDKCSHNTEVGETRSSTPEMPAVSAFFSLAALAEVAAMEN    841 - 910
VHRGQRSTPLTHDGQPKEMPQAPVLISCADQ                                           911 - 941
//

Text Mined References (20)

PMID Year Title