Property Summary

NCBI Gene PubMed Count 12
PubMed Score 31.57
PubTator Score 11.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Rheumatoid Arthritis 1.300 0.011
psoriasis 1.900 0.000
osteosarcoma 3.508 0.000
ependymoma 1.100 0.000
astrocytoma 1.400 0.010
glioblastoma 1.600 0.000
medulloblastoma, large-cell -1.200 0.009
Crohn's disease -1.066 0.001
ulcerative colitis 1.300 0.000
juvenile dermatomyositis 1.717 0.000
Amyotrophic Lateral Sclerosis 1.202 0.000
acute quadriplegic myopathy 1.571 0.000
pancreatic ductal adenocarcinoma liver m... 1.567 0.004
adult high grade glioma 1.200 0.012
group 4 medulloblastoma -1.700 0.003
Pick disease 2.100 0.000
ovarian cancer 2.200 0.000
Down syndrome 1.200 0.003
dermatomyositis 1.100 0.002

Synonym

Accession Q8WY36 A2RRM7 Q2TAJ1 Q7L3J8 Q7LBY8 Q8NDB0 Q8WY35 Q9H0J6
Symbols HBP2
ARTC1
MDS001
HSPC339

Gene

BBX

Gene RIF (1)

PMID Text
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKGSNRNKDHSAEGEGVGKRPKRKCLQWHPLLAKKLLDFSEEEEEEDEEEDIDKVQLLGADGLEQDVGET      1 - 70
EDDESPEQRARRPMNAFLLFCKRHRSLVRQEHPRLDNRGATKILADWWAVLDPKEKQKYTDMAKEYKDAF     71 - 140
MKANPGYKWCPTTNKPVKSPTPTVNPRKKLWAFPSDSSRDLPSPKKAKTEEMPQLNFGMADPTQMGGLSM    141 - 210
LLLAGEHALGTPEVSSGTCRPDVSESPELRQKSPLFQFAEISSSTSHSDASTKQCQTSALFQFAEISSNT    211 - 280
SQLGGAEPVKRCGKSALFQLAEMCLASEGMKMEESKLIKAKESDGGRIKELEKGKEEKEIKMEKTDETRL    281 - 350
QKEAEFEKSAKENLRDSKELRNFEALQIDDIMAIKMEDPKEIRKEELEEDHKCSHFPDFSYSASSKIIIS    351 - 420
DVPSRKDHMCHPHGIMIIEDPAALNKPEKLKKKKKKSKMDRHGNDKSTPKKTCKKRQSSESDIESVIYTI    421 - 490
EAVAKGDWGIEKLGDTPRKKVRTSSSGKGSILDAKPPKKKVKSREKKMSKEKSSDTTKESRPPDFISISA    491 - 560
SKNISGETPEGIKAEPLTPMEDALPPSLSGQAKPEDSDCHRKIETCGSRKSERSCKGALYKTLVSEGMLT    561 - 630
SLRANVDRGKRSSGKGNSSDHEGCWNEESWTFSQSGTSGSKKFKKTKPKEDCLLGSAKLDEEFEKKFNSL    631 - 700
PQYSPVTFDRKCVPVPRKKKKTGNVSSEPTKTSKGPFQSQKKNLFHKIVSKYKHKKEKPNVPEKGSGDKW    701 - 770
SNKQLFLDAIHPTEAIFSEDRNTMEPVHKVKNIPSIFNTPEPTTTQEPLVGSQKRKARKTKITHLVRTAD    771 - 840
GRVSPAGGTLDDKPKEQLQRSLPKATETDCNDKCSHNTEVGETRSSTPEMPAVSAFFSLAALAEVAAMEN    841 - 910
VHRGQRSTPLTHDGQPKEMPQAPVLISCADQ                                           911 - 941
//

Publication (19)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19247474 2009 Genome-wide and candidate gene association study of cigarette smoking behaviors.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...