Property Summary

NCBI Gene PubMed Count 6
PubMed Score 5.24
PubTator Score 12.67

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8WY22 Q8WY23 I3-binding protein
Symbols KG19
BNAS1
HCCR-1
HCCR-2
HCCRBP-1
HCCRBP-3

Gene

Gene RIF (2)

PMID Text
17765869 Taken together, BRI3BP, widely expressed in animal cell types, seems to possess a pro-apoptotic property and can potentiate drug-induced apoptosis.
11860200 highly expressed in brain, kidney, and liver; mapped to human chromosome 12q24.2-qter

AA Sequence

MGARASGGPLARAGLLLLLLLLLLLGLLAPGAQGARGRGGAEKNSYRRTVNTFSQSVSSLFGEDNVRAAQ      1 - 70
KFLARLTERFVLGVDMFVETLWKVWTELLDVLGLDVSNLSQYFSPASVSSSPARALLLVGVVLLAYWFLS     71 - 140
LTLGFTFSVLHVVFGRFFWIVRVVLFSMSCVYILHKYEGEPENAVLPLCFVVAVYFMTGPMGFYWRSSPS    141 - 210
GPSNPSNPSVEEKLEHLEKQVRLLNIRLNRVLESLDRSKDK                                 211 - 251
//

Publication (9)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17943721 2008 HCCRBP-1 directly interacting with HCCR-1 induces tumorigenesis through P53 stabilization.
17765869 2007 Augmentation of drug-induced cell death by ER protein BRI3BP.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11860200 2001 Cloning, tissue expression pattern, and chromosome location of a novel human gene BRI3BP.