Property Summary

NCBI Gene PubMed Count 6
PubMed Score 5.24
PubTator Score 12.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
breast carcinoma 1614 1.28555746747103E-21
non-small cell lung cancer 2798 7.33389637697936E-18
lung adenocarcinoma 2714 1.2252254649559E-11
adult high grade glioma 2148 2.12531158337635E-5
glioblastoma 5572 6.63549777734819E-5
medulloblastoma, large-cell 6234 6.73289295670863E-5
invasive ductal carcinoma 2950 2.80979302497164E-4
nasopharyngeal carcinoma 1056 3.39921816801103E-4
tuberculosis 1563 0.00127963378286579
primary Sjogren syndrome 789 0.00129498876314432
sonic hedgehog group medulloblastoma 1482 0.00172802869670263
ovarian cancer 8492 0.0018967876351596
ductal carcinoma in situ 1745 0.00232466362356575
osteosarcoma 7933 0.00236803640494355
ependymoma 2514 0.00321411832696838
adrenocortical carcinoma 1427 0.00354776078941046
primitive neuroectodermal tumor 3031 0.00356183052979931
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00435048381981306
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00562879697935241
astrocytic glioma 2241 0.00736677877517677
non-inflammatory breast cancer 208 0.00936935936012564
subependymal giant cell astrocytoma 2287 0.0152408661189447
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0281901521311128
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0
Disease Target Count Z-score Confidence
Leptospirosis 17 3.803 1.9

Expression

Synonym

Accession Q8WY22 Q8WY23 I3-binding protein
Symbols KG19
BNAS1
HCCR-1
HCCR-2
HCCRBP-1
HCCRBP-3

Gene

  Ortholog (8)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (2)

PMID Text
17765869 Taken together, BRI3BP, widely expressed in animal cell types, seems to possess a pro-apoptotic property and can potentiate drug-induced apoptosis.
11860200 highly expressed in brain, kidney, and liver; mapped to human chromosome 12q24.2-qter

AA Sequence

MGARASGGPLARAGLLLLLLLLLLLGLLAPGAQGARGRGGAEKNSYRRTVNTFSQSVSSLFGEDNVRAAQ      1 - 70
KFLARLTERFVLGVDMFVETLWKVWTELLDVLGLDVSNLSQYFSPASVSSSPARALLLVGVVLLAYWFLS     71 - 140
LTLGFTFSVLHVVFGRFFWIVRVVLFSMSCVYILHKYEGEPENAVLPLCFVVAVYFMTGPMGFYWRSSPS    141 - 210
GPSNPSNPSVEEKLEHLEKQVRLLNIRLNRVLESLDRSKDK                                 211 - 251
//

Text Mined References (9)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17943721 2008 HCCRBP-1 directly interacting with HCCR-1 induces tumorigenesis through P53 stabilization.
17765869 2007 Augmentation of drug-induced cell death by ER protein BRI3BP.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11860200 2001 Cloning, tissue expression pattern, and chromosome location of a novel human gene BRI3BP.