Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.24
PubTator Score 12.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adrenocortical carcinoma 1.303 3.5e-03
adult high grade glioma -1.300 4.7e-03
astrocytic glioma -2.200 7.4e-03
Breast cancer 1.400 2.6e-16
breast carcinoma 1.200 1.3e-21
ductal carcinoma in situ 1.300 2.3e-03
ependymoma -2.400 3.2e-03
glioblastoma -1.200 3.2e-06
intraductal papillary-mucinous adenoma (... 1.400 2.8e-02
intraductal papillary-mucinous carcinoma... 2.200 4.4e-03
intraductal papillary-mucinous neoplasm ... 3.000 5.6e-03
invasive ductal carcinoma 1.200 2.8e-04
lung adenocarcinoma 1.800 1.2e-11
medulloblastoma -1.100 1.0e-02
medulloblastoma, large-cell -1.600 6.7e-05
nasopharyngeal carcinoma 1.200 3.4e-04
non-small cell lung cancer 1.635 7.3e-18
osteosarcoma -1.603 2.4e-03
ovarian cancer 1.700 1.9e-03
primary Sjogren syndrome 1.400 1.3e-03
primitive neuroectodermal tumor -1.200 3.6e-03
subependymal giant cell astrocytoma -1.880 1.5e-02
tuberculosis 1.300 1.3e-03

Gene RIF (3)

AA Sequence

MGARASGGPLARAGLLLLLLLLLLLGLLAPGAQGARGRGGAEKNSYRRTVNTFSQSVSSLFGEDNVRAAQ      1 - 70
KFLARLTERFVLGVDMFVETLWKVWTELLDVLGLDVSNLSQYFSPASVSSSPARALLLVGVVLLAYWFLS     71 - 140
LTLGFTFSVLHVVFGRFFWIVRVVLFSMSCVYILHKYEGEPENAVLPLCFVVAVYFMTGPMGFYWRSSPS    141 - 210
GPSNPSNPSVEEKLEHLEKQVRLLNIRLNRVLESLDRSKDK                                 211 - 251
//

Text Mined References (11)

PMID Year Title