Property Summary

NCBI Gene PubMed Count 12
PubMed Score 146.57
PubTator Score 31.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.400 1.5e-02
Breast cancer -1.100 1.2e-51
group 4 medulloblastoma 1.200 4.9e-03
invasive ductal carcinoma -2.295 4.3e-04
primitive neuroectodermal tumor 1.400 9.1e-03
psoriasis -1.200 3.9e-07

Gene RIF (5)

AA Sequence

MPWQAFRRFGQKLVRRRTLESGMAETRLARCLSTLDLVALGVGSTLGAGVYVLAGEVAKDKAGPSIVICF      1 - 70
LVAALSSVLAGLCYAEFGARVPRSGSAYLYSYVTVGELWAFTTGWNLILSYVIGTASVARAWSSAFDNLI     71 - 140
GNHISKTLQGSIALHVPHVLAEYPDFFALGLVLLLTGLLALGASESALVTKVFTGVNLLVLGFVMISGFV    141 - 210
KGDVHNWKLTEEDYELAMAELNDTYSLGPLGSGGFVPFGFEGILRGAATCFYAFVGFDCIATTGEEAQNP    211 - 280
QRSIPMGIVISLSVCFLAYFAVSSALTLMMPYYQLQPESPLPEAFLYIGWAPARYVVAVGSLCALSTSLL    281 - 350
GSMFPMPRVIYAMAEDGLLFRVLARIHTGTRTPIIATVVSGIIAAFMAFLFKLTDLVDLMSIGTLLAYSL    351 - 420
VSICVLILRYQPDQETKTGEEVELQEEAITTESEKLTLWGLFFPLNSIPTPLSGQIVYVCSSLLAVLLTA    421 - 490
LCLVLAQWSVPLLSGDLLWTAVVVLLLLLIIGIIVVIWRQPQSSTPLHFKVPALPLLPLMSIFVNIYLMM    491 - 560
QMTAGTWARFGVWMLIGFAIYFGYGIQHSLEEIKSNQPSRKSRAKTVDLDPGTLYVHSV               561 - 619
//

Text Mined References (15)

PMID Year Title