Property Summary

NCBI Gene PubMed Count 46
PubMed Score 42.80
PubTator Score 40.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Epilepsy 792 0.0 0.0
MENTAL RETARDATION, AUTOSOMAL DOMINANT 26 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.8
Disease Target Count Z-score Confidence
Bipolar Disorder 666 0.0 1.0
substance-related disorder 162 0.0 3.0

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma 1.201 1.8e-02
Astrocytoma, Pilocytic -1.800 2.5e-08
atypical teratoid / rhabdoid tumor 1.100 6.4e-03
Breast cancer -1.300 1.4e-05
dermatomyositis 1.500 7.1e-04
fibroadenoma 1.300 1.0e-02
group 3 medulloblastoma 1.900 1.9e-06
juvenile dermatomyositis 1.123 3.1e-06
lung cancer -1.100 1.2e-03
lung carcinoma -1.100 5.9e-13
malignant mesothelioma 3.300 8.3e-08
medulloblastoma, large-cell 1.900 8.5e-05
osteosarcoma 1.900 2.6e-03
ovarian cancer -1.600 5.1e-03
pancreatic cancer 1.500 1.6e-03
posterior fossa group B ependymoma 1.400 2.1e-06
primary pancreatic ductal adenocarcinoma 1.496 1.9e-03
tuberculosis -2.100 1.5e-06
Waldenstrons macroglobulinemia -1.442 6.4e-03

 GO Function (1)

Gene RIF (31)

AA Sequence

MDGPTRGHGLRKKRRSRSQRDRERRSRGGLGAGAAGGGGAGRTRALSLASSSGSDKEDNGKPPSSAPSRP      1 - 70
RPPRRKRRESTSAEEDIIDGFAMTSFVTFEALEKDVALKPQERVEKRQTPLTKKKREALTNGLSFHSKKS     71 - 140
RLSHPHHYSSDRENDRNLCQHLGKRKKMPKALRQLKPGQNSCRDSDSESASGESKGFHRSSSRERLSDSS    141 - 210
APSSLGTGYFCDSDSDQEEKASDASSEKLFNTVIVNKDPELGVGTLPEHDSQDAGPIVPKISGLERSQEK    211 - 280
SQDCCKEPIFEPVVLKDPCPQVAQPIPQPQTEPQLRAPSPDPDLVQRTEAPPQPPPLSTQPPQGPPEAQL    281 - 350
QPAPQPQVQRPPRPQSPTQLLHQNLPPVQAHPSAQSLSQPLSAYNSSSLSLNSLSSSRSSTPAKTQPAPP    351 - 420
HISHHPSASPFPLSLPNHSPLHSFTPTLQPPAHSHHPNMFAPPTALPPPPPLTSGSLQVAGHPAGSTYSE    421 - 490
QDILRQELNTRFLASQSADRGASLGPPPYLRTEFHQHQHQHQHTHQHTHQHTFTPFPHAIPPTAIMPTPA    491 - 560
PPMFDKYPTKVDPFYRHSLFHSYPPAVSGIPPMIPPTGPFGSLQGAFQPKTSNPIDVAARPGTVPHTLLQ    561 - 630
KDPRLTDPFRPMLRKPGKWCAMHVHIAWQIYHHQQKVKKQMQSDPHKLDFGLKPEFLSRPPGPSLFGAIH    631 - 700
HPHDLARPSTLFSAAGAAHPTGTPFGPPPHHSNFLNPAAHLEPFNRPSTFTGLAAVGGNAFGGLGNPSVT    701 - 770
PNSMFGHKDGPSVQNFSNPHEPWNRLHRTPPSFPTPPPWLKPGELERSASAAAHDRDRDVDKRDSSVSKD    771 - 840
DKERESVEKRHSSHPSPAPVLPVNALGHTRSSTEQIRAHLNTEAREKDKPKERERDHSESRKDLAADEHK    841 - 910
AKEGHLPEKDGHGHEGRAAGEEAKQLARVPSPYVRTPVVESARPNSTSSREAEPRKGEPAYENPKKSSEV    911 - 980
KVKEERKEDHDLPPEAPQTHRASEPPPPNSSSSVHPGPLASMPMTVGVTGIHPMNSISSLDRTRMMTPFM    981 - 1050
GISPLPGGERFPYPSFHWDPIRDPLRDPYRELDIHRRDPLGRDFLLRNDPLHRLSTPRLYEADRSFRDRE   1051 - 1120
PHDYSHHHHHHHHPLSVDPRREHERGGHLDERERLHMLREDYEHTRLHSVHPASLDGHLPHPSLITPGLP   1121 - 1190
SMHYPRISPTAGNQNGLLNKTPPTAALSAPPPLISTLGGRPVSPRRTTPLSAEIRERPPSHTLKDIEAR    1191 - 1259
//

Text Mined References (50)

PMID Year Title