Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.39
PubTator Score 2.53

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 4.79910567391892E-12
nasopharyngeal carcinoma 1056 7.90401065041867E-8
ovarian cancer 8492 2.75255395702411E-7
medulloblastoma, large-cell 6234 0.00454489700267605
lung cancer 4473 0.00918241140414284
chronic rhinosinusitis 512 0.0222801272759549
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Primary ciliary dyskinesia 75 3.904 2.0
Craniopharyngioma 13 3.762 1.9


  Differential Expression (6)

Disease log2 FC p
posterior fossa group B ependymoma 2.900 0.000
medulloblastoma, large-cell -1.100 0.005
lung cancer 1.100 0.009
nasopharyngeal carcinoma -1.500 0.000
ovarian cancer -1.200 0.000
chronic rhinosinusitis -1.872 0.022

Gene RIF (2)

20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
11877439 These studies identify DNAH7 as an inner arm component of human cilia that is synthesized but not assembled in a case of primary ciliary dyskinesia.

AA Sequence

GHSTNFVIAMTLPSDQPKEHWIGRGVALLCQLNS                                       3991 - 4024

Text Mined References (11)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11877439 2002 Identification of dynein heavy chain 7 as an inner arm component of human cilia that is synthesized but not assembled in a case of primary ciliary dyskinesia.
11175280 2000 Identification, tissue specific expression, and chromosomal localisation of several human dynein heavy chain genes.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.