Property Summary

NCBI Gene PubMed Count 43
Grant Count 18
R01 Count 8
Funding $2,078,113.75
PubMed Score 45.32
PubTator Score 52.60

Knowledge Summary

Patent

No data available

Expression

Gene RIF (37)

PMID Text
24362368 promoter SNP rs12899331 of DYX1C1 may contribute towards the manifestation of DD. This study supports the association of DYX1C1 with DD in an Indian population
23872636 DYX1C1 is required for axonemal dynein assembly and ciliary motility.
23341075 The results of this study do not provide evidence for association between the putatively functional single nucleotide polymorphisms -3G/A and 1249G/T in DYX1C1 and reading disabilities.
23176554 Gene-by-environment effects were found between some specified environmental moderators (i.e. maternal smoke during pregnancy, birth weight and socio-economic status) and the DYX1C1-1259C/G marker
23065966 results suggested that the 931C > T variant in KIAA0319, but not the -3G > A in DYX1C1, was significantly associated with the risk of dyslexia
23036959 results demonstrate that DYX1C1 can modulate the expression of genes involved in cell migration and nervous system development and associates with a number of cytoskeletal proteins.
23028439 DYX1C1 influences reading development in the general Chinese population and supports a universal effect of this gene.
22683091 The results of this study found that DYX1C1 gene contained polymorphisms that were significantly associated with white matter volume in the left temporo-parietal region and that white matter volume influenced reading ability.
22558177 Mutations in cilia co-expressed DCDC2, DYX1C1 and KIAA0319 genes are associated with a cognitive neurological disorder, dyslexia.
22383464 A single nucleotide polymorphism previously shown to be associated with dyslexia and located in the cis-regulatory region of DYX1C1 may alter the epigenetic and endocrine regulation of this gene.
More...

AA Sequence

MPLQVSDYSWQQTKTAVFLSLPLKGVCVRDTDVFCTENYLKVNFPPFLFEAFLYAPIDDESSKAKIGNDT      1 - 70
IVFTLYKKEAAMWETLSVTGVDKEMMQRIREKSILQAQERAKEATEAKAAAKREDQKYALSVMMKIEEEE     71 - 140
RKKIEDMKENERIKATKALEAWKEYQRKAEEQKKIQREEKLCQKEKQIKEERKKIKYKSLTRNLASRNLA    141 - 210
PKGRNSENIFTEKLKEDSIPAPRSVGSIKINFTPRVFPTALRESQVAEEEEWLHKQAEARRAMNTDIAEL    211 - 280
CDLKEEEKNPEWLKDKGNKLFATENYLAAINAYNLAIRLNNKMPLLYLNRAACHLKLKNLHKAIEDSSKA    281 - 350
LELLMPPVTDNANARMKAHVRRGTAFCQLELYVEGLQDYEAALKIDPSNKIVQIDAEKIRNVIQGTELKS    351 - 420
//

Text Mined References (44)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
25186273 2014 Ciliary beat pattern and frequency in genetic variants of primary ciliary dyskinesia.
24362368 2014 Association of SNPs of DYX1C1 with developmental dyslexia in an Indian population.
23872636 2013 DYX1C1 is required for axonemal dynein assembly and ciliary motility.
23341075 2013 A family-based association analysis and meta-analysis of the reading disabilities candidate gene DYX1C1.
23176554 2013 An assessment of gene-by-environment interactions in developmental dyslexia-related phenotypes.
23065966 2012 Genetic variant in KIAA0319, but not in DYX1C1, is associated with risk of dyslexia: an integrated meta-analysis.
23036959 2013 Molecular networks of DYX1C1 gene show connection to neuronal migration genes and cytoskeletal proteins.
23028439 2012 Association of the DYX1C1 dyslexia susceptibility gene with orthography in the Chinese population.
More...