Property Summary

NCBI Gene PubMed Count 45
PubMed Score 48.57
PubTator Score 52.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease 1.149 4.1e-02
adult high grade glioma 1.100 1.9e-03
Astrocytoma, Pilocytic 1.300 9.6e-07
atypical teratoid / rhabdoid tumor 2.200 1.6e-04
ependymoma 3.400 2.6e-20
glioblastoma 1.700 2.4e-06
group 3 medulloblastoma 2.200 9.2e-07
nasopharyngeal carcinoma -1.800 6.2e-04
primitive neuroectodermal tumor 1.700 1.6e-03

Protein-protein Interaction (1)

Gene RIF (38)

AA Sequence

MPLQVSDYSWQQTKTAVFLSLPLKGVCVRDTDVFCTENYLKVNFPPFLFEAFLYAPIDDESSKAKIGNDT      1 - 70
IVFTLYKKEAAMWETLSVTGVDKEMMQRIREKSILQAQERAKEATEAKAAAKREDQKYALSVMMKIEEEE     71 - 140
RKKIEDMKENERIKATKALEAWKEYQRKAEEQKKIQREEKLCQKEKQIKEERKKIKYKSLTRNLASRNLA    141 - 210
PKGRNSENIFTEKLKEDSIPAPRSVGSIKINFTPRVFPTALRESQVAEEEEWLHKQAEARRAMNTDIAEL    211 - 280
CDLKEEEKNPEWLKDKGNKLFATENYLAAINAYNLAIRLNNKMPLLYLNRAACHLKLKNLHKAIEDSSKA    281 - 350
LELLMPPVTDNANARMKAHVRRGTAFCQLELYVEGLQDYEAALKIDPSNKIVQIDAEKIRNVIQGTELKS    351 - 420
//

Text Mined References (46)

PMID Year Title