Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.01
PubTator Score 1.07

Knowledge Summary

Patent (1,183)

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.300 9.4e-04
atypical teratoid / rhabdoid tumor -1.200 1.7e-04
ependymoma -1.100 7.4e-03
glioblastoma -1.200 3.3e-05
group 3 medulloblastoma -2.200 5.6e-05
medulloblastoma, large-cell -1.200 9.2e-04
osteosarcoma 1.347 2.5e-06
Pick disease -1.100 3.1e-03
pituitary cancer 1.300 1.9e-04
primitive neuroectodermal tumor -1.200 1.0e-03

Protein-protein Interaction (3)

Gene RIF (2)

AA Sequence

MESLKRWNEERGLWCEKGVQVLLTTVGAFAAFGLMTIAISTDYWLYTRALICNTTNLTAGGDDGTPHRGG      1 - 70
GGASEKKDPGGLTHSGLWRICCLEGLKRGVCVKINHFPEDTDYDHDSAEYLLRVVRASSIFPILSAILLL     71 - 140
LGGVCVAASRVYKSKRNIILGAGILFVAAGLSNIIGVIVYISANAGEPGPKRDEEKKNHYSYGWSFYFGG    141 - 210
LSFILAEVIGVLAVNIYIERSREAHCQSRSDLLKAGGGAGGSGGSGPSAILRLPSYRFRYRRRSRSSSRS    211 - 280
SEPSPSRDASPGGPGGPGFASTDISMYTLSRDPSKGSVAAGLAGAGGGGGGAVGAFGGAAGGAGGGGGGG    281 - 350
GGAGAERDRGGASGFLTLHNAFPKEAGGGVTVTVTGPPAPPAPAPPAPSAPAPGTLAKEAAASNTNTLNR    351 - 420
KTTPV                                                                     421 - 425
//

Text Mined References (11)

PMID Year Title