Property Summary

NCBI Gene PubMed Count 9
Grant Count 9
R01 Count 9
Funding $512,229.15
PubMed Score 2.01
PubTator Score 1.07

Knowledge Summary

Patent (1,183)

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma -1.300 0.000
osteosarcoma 1.347 0.000
group 3 medulloblastoma -2.200 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.200 0.001
primitive neuroectodermal tumor -1.200 0.001
adult high grade glioma -1.300 0.001
Pick disease -1.100 0.003
pituitary cancer 1.300 0.000

Gene RIF (1)

PMID Text
26710323 Patients with Dilated Cardiomyopathy and Sustained Monomorphic Ventricular Tachycardia Show Up-Regulation of KCNN3 and KCNJ2 Genes and CACNG8-Linked Left Ventricular Dysfunction

AA Sequence

MESLKRWNEERGLWCEKGVQVLLTTVGAFAAFGLMTIAISTDYWLYTRALICNTTNLTAGGDDGTPHRGG      1 - 70
GGASEKKDPGGLTHSGLWRICCLEGLKRGVCVKINHFPEDTDYDHDSAEYLLRVVRASSIFPILSAILLL     71 - 140
LGGVCVAASRVYKSKRNIILGAGILFVAAGLSNIIGVIVYISANAGEPGPKRDEEKKNHYSYGWSFYFGG    141 - 210
LSFILAEVIGVLAVNIYIERSREAHCQSRSDLLKAGGGAGGSGGSGPSAILRLPSYRFRYRRRSRSSSRS    211 - 280
SEPSPSRDASPGGPGGPGFASTDISMYTLSRDPSKGSVAAGLAGAGGGGGGAVGAFGGAAGGAGGGGGGG    281 - 350
GGAGAERDRGGASGFLTLHNAFPKEAGGGVTVTVTGPPAPPAPAPPAPSAPAPGTLAKEAAASNTNTLNR    351 - 420
KTTPV                                                                     421 - 425
//

Text Mined References (10)

PMID Year Title
26710323 2015 Patients with Dilated Cardiomyopathy and Sustained Monomorphic Ventricular Tachycardia Show Up-Regulation of KCNN3 and KCNJ2 Genes and CACNG8-Linked Left Ventricular Dysfunction.
21172611 2010 Hippocampal AMPA receptor gating controlled by both TARP and cornichon proteins.
20805473 2010 Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating.
18311135 2008 Motor protein-dependent transport of AMPA receptors into spines during long-term potentiation.
18304745 2009 Functional modulation of AMPA receptors by transmembrane AMPA receptor regulatory proteins.
17652770 2007 Calcium channel gamma subunits: a functionally diverse protein family.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11738816 2001 Calcium channel gamma subunits provide insights into the evolution of this gene family.
11170751 2001 A cluster of three novel Ca2+ channel gamma subunit genes on chromosome 19q13.4: evolution and expression profile of the gamma subunit gene family.