Property Summary

NCBI Gene PubMed Count 3
PubMed Score 608.53
PubTator Score 242.64

Knowledge Summary

Patent (25,758)

TINX Plot

  Disease Sources (3)

Disease Target Count
Animal Mammary Neoplasms 136
Disease Target Count P-value
ovarian cancer 8492 6.68945429446675E-25
lung carcinoma 2844 6.24628056239111E-11
osteosarcoma 7933 1.75950792115267E-6
ulcerative colitis 2087 3.18788857253534E-6
cystic fibrosis 1670 4.40960818394673E-5
ductal carcinoma in situ 1745 6.50997567187662E-4
pediatric high grade glioma 2712 0.001291606026489
breast carcinoma 1614 0.00131700371921878
invasive ductal carcinoma 2950 0.00166640479701609
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00449816883948015
glioblastoma 5572 0.00466711959006312
fibroadenoma 557 0.00789243725998305
spina bifida 1064 0.039885925148645
subependymal giant cell astrocytoma 2287 0.0445679115772152
Disease Target Count Z-score Confidence
Cancer 2346 3.426 1.7
Dental caries 67 3.262 1.6
Gastroschisis 9 3.089 1.5

Expression

  Differential Expression (14)

Disease log2 FC p
osteosarcoma 1.853 0.000
glioblastoma 1.700 0.005
pancreatic ductal adenocarcinoma liver m... -1.212 0.004
breast carcinoma -1.900 0.001
fibroadenoma -2.800 0.008
cystic fibrosis -1.800 0.000
pediatric high grade glioma 1.400 0.001
subependymal giant cell astrocytoma 2.068 0.045
lung carcinoma -1.200 0.000
spina bifida 1.260 0.040
ductal carcinoma in situ -3.100 0.001
invasive ductal carcinoma -3.300 0.002
ulcerative colitis -2.600 0.000
ovarian cancer -3.300 0.000

Synonym

Accession Q8WXS4
Symbols PR
PR1

Gene

  Ortholog (10)

Gene RIF (1)

PMID Text
22632162 HIV-1 Tat 47-59 peptide downregulates gene expression of transmembrane protein 37 (TMEM37) in U-937 macrophages

AA Sequence

MTAVGVQAQRPLGQRQPRRSFFESFIRTLIITCVALAVVLSSVSICDGHWLLAEDRLFGLWHFCTTTNQT      1 - 70
ICFRDLGQAHVPGLAVGMGLVRSVGALAVVAAIFGLEFLMVSQLCEDKHSQCKWVMGSILLLVSFVLSSG     71 - 140
GLLGFVILLRNQVTLIGFTLMFWCEFTASFLLFLNAISGLHINSITHPWE                        141 - 190
//

Text Mined References (4)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11738816 2001 Calcium channel gamma subunits provide insights into the evolution of this gene family.
10734232 2000 A family of gamma-like calcium channel subunits.