Property Summary

NCBI Gene PubMed Count 3
PubMed Score 668.07
PubTator Score 242.64

Knowledge Summary

Patent (25,758)

Expression

  Differential Expression (14)

Disease log2 FC p
breast carcinoma -1.900 1.3e-03
cystic fibrosis -1.700 1.3e-03
ductal carcinoma in situ -1.600 2.9e-04
fibroadenoma -2.800 7.9e-03
glioblastoma 1.200 1.2e-04
invasive ductal carcinoma -1.700 2.1e-03
lung carcinoma -1.200 6.2e-11
osteosarcoma 1.853 1.8e-06
ovarian cancer -3.300 6.7e-25
pancreatic ductal adenocarcinoma liver m... -1.212 4.5e-03
pediatric high grade glioma 1.400 1.3e-03
spina bifida 1.260 4.0e-02
subependymal giant cell astrocytoma 2.068 4.5e-02
ulcerative colitis -1.900 2.3e-06

Gene RIF (1)

AA Sequence

MTAVGVQAQRPLGQRQPRRSFFESFIRTLIITCVALAVVLSSVSICDGHWLLAEDRLFGLWHFCTTTNQT      1 - 70
ICFRDLGQAHVPGLAVGMGLVRSVGALAVVAAIFGLEFLMVSQLCEDKHSQCKWVMGSILLLVSFVLSSG     71 - 140
GLLGFVILLRNQVTLIGFTLMFWCEFTASFLLFLNAISGLHINSITHPWE                        141 - 190
//

Text Mined References (4)

PMID Year Title