Property Summary

NCBI Gene PubMed Count 3
Grant Count 35
R01 Count 19
Funding $3,426,619.55
PubMed Score 608.53
PubTator Score 242.64

Knowledge Summary

Patent (25,758)

Expression

  Differential Expression (14)

Disease log2 FC p
osteosarcoma 1.853 0.000
glioblastoma 1.700 0.005
pancreatic ductal adenocarcinoma liver m... -1.212 0.004
breast carcinoma -1.900 0.001
fibroadenoma -2.800 0.008
cystic fibrosis -1.800 0.000
pediatric high grade glioma 1.400 0.001
subependymal giant cell astrocytoma 2.068 0.045
lung carcinoma -1.200 0.000
spina bifida 1.260 0.040
ductal carcinoma in situ -3.100 0.001
invasive ductal carcinoma -3.300 0.002
ulcerative colitis -2.600 0.000
ovarian cancer -3.300 0.000

Gene RIF (1)

PMID Text
22632162 HIV-1 Tat 47-59 peptide downregulates gene expression of transmembrane protein 37 (TMEM37) in U-937 macrophages

AA Sequence

MTAVGVQAQRPLGQRQPRRSFFESFIRTLIITCVALAVVLSSVSICDGHWLLAEDRLFGLWHFCTTTNQT      1 - 70
ICFRDLGQAHVPGLAVGMGLVRSVGALAVVAAIFGLEFLMVSQLCEDKHSQCKWVMGSILLLVSFVLSSG     71 - 140
GLLGFVILLRNQVTLIGFTLMFWCEFTASFLLFLNAISGLHINSITHPWE                        141 - 190
//

Publication (4)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11738816 2001 Calcium channel gamma subunits provide insights into the evolution of this gene family.
10734232 2000 A family of gamma-like calcium channel subunits.