Property Summary

NCBI Gene PubMed Count 39
PubMed Score 47.92
PubTator Score 49.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -4.400 2.1e-08
ependymoma -1.300 8.9e-03
group 3 medulloblastoma -1.900 9.5e-04
lung adenocarcinoma -1.300 1.3e-08
lung cancer -1.200 6.6e-03
medulloblastoma, large-cell -3.600 2.0e-05
mucosa-associated lymphoid tissue lympho... -1.042 1.8e-02
oligodendroglioma 1.400 3.2e-03
Pick disease -1.200 7.5e-04
primitive neuroectodermal tumor -2.100 2.9e-02
spina bifida 1.923 4.8e-02

Gene RIF (33)

AA Sequence

MGCGGSRADAIEPRYYESWTRETESTWLTYTDSDAPPSAAAPDSGPEAGGLHSVLEAEKSKIKAPTDSVS      1 - 70
DEGLFSASKMAPLAVFSHGMLEDGLPSNGVPRSTAPGGIPNPEKKTNCETQCPNPQSLSSGPLTQKQNGL     71 - 140
QTTEAKRDAKRMPAKEVTINVTDSIQQMDRSRRITKNCVN                                  141 - 180
//

Text Mined References (39)

PMID Year Title