Property Summary

NCBI Gene PubMed Count 37
PubMed Score 45.86
PubTator Score 49.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Leukemia, Myelocytic, Acute 113
Disease Target Count P-value
atypical teratoid/rhabdoid tumor 1095 1.21376553400362E-12
sonic hedgehog group medulloblastoma 1482 1.30160421520675E-9
lung adenocarcinoma 2714 1.27298531806795E-8
medulloblastoma, large-cell 6234 1.95793639714074E-5
Pick disease 1893 7.53871763850748E-4
oligodendroglioma 2849 0.00318568664330077
lung cancer 4473 0.00664591437741543
ependymoma 2514 0.00891942886897111
mucosa-associated lymphoid tissue lymphoma 480 0.0184026991719386
primitive neuroectodermal tumor 3031 0.0204727860959646
spina bifida 1064 0.0480915845743468
Disease Target Count Z-score Confidence
acute myeloid leukemia 785 5.351 2.7
Acute leukemia 8 3.587 1.8

Expression

  Differential Expression (11)

Disease log2 FC p
oligodendroglioma 1.400 0.003
ependymoma -1.300 0.009
sonic hedgehog group medulloblastoma -3.600 0.000
atypical teratoid/rhabdoid tumor -4.600 0.000
medulloblastoma, large-cell -3.600 0.000
primitive neuroectodermal tumor -2.200 0.020
lung cancer -1.200 0.007
lung adenocarcinoma -1.300 0.000
spina bifida 1.923 0.048
Pick disease -1.200 0.001
mucosa-associated lymphoid tissue lympho... -1.042 0.018

Synonym

Accession Q8WXS3 Q8WTP6 Q8WXS0 Q8WXS1 Q8WXS2 Q9HA93
Symbols

Gene

  Ortholog (7)

Gene RIF (31)

PMID Text
26625814 BAALC and ERG genes are specific significant molecular markers in acute myeloid leukemia disease progression, response to treatment and survival.
26430723 combined determination of both miR-3151 and BAALC improved this prognostic stratification, with patients with low levels of both parameters showing a better outcome compared with those patients harboring increased levels of one or both markers
26050649 demonstrated that BAALC blocks ERK-mediated monocytic differentiation of acute myeloid leukemia cells by trapping Kruppel-like factor 4 (KLF4) in the cytoplasm and inhibiting its function in the nucleus
26012361 Evaluating WT1 and BAALC gene expression at diagnosis may improve standard risk stratification and possibly refine the therapeutic approach for Myelodysplastic Syndromes patients.
25428390 study indicates that overexpression of BAALC serves as an independent prognostic biomarker in acute myeloid leukemia
24855032 Thus low MDR1/low BAALC expression identifies a subgroup of intermediate cytogenetic risk AML patients with a remarkably good long-term outcome achieved by chemotherapy alone.
24736457 miR-3151 introns within BAALC have roles in driving leukemogenesis by deregulating the TP53 pathway
23865362 Investigated the prognostic impact of brain and acute leukemia, cytoplasmic (BAALC) expression in acute myeloid leukemia with normal karyotype.
23760853 BAALC overexpression retains its negative prognostic role across all cytogenetic risk groups in acute myeloid leukemia patients.
23672350 higher post-HSCT BAALC and WT1 expressions in patients with CBF-AML may be good markers of minimal residual disease for the prediction of survival and relapse after HSCT.
More...

AA Sequence

MGCGGSRADAIEPRYYESWTRETESTWLTYTDSDAPPSAAAPDSGPEAGGLHSVLEAEKSKIKAPTDSVS      1 - 70
DEGLFSASKMAPLAVFSHGMLEDGLPSNGVPRSTAPGGIPNPEKKTNCETQCPNPQSLSSGPLTQKQNGL     71 - 140
QTTEAKRDAKRMPAKEVTINVTDSIQQMDRSRRITKNCVN                                  141 - 180
//

Text Mined References (37)

PMID Year Title
26625814 2015 Relation of BAALC and ERG Gene Expression with Overall Survival in Acute Myeloid Leukemia Cases.
26430723 2015 The expression level of BAALC-associated microRNA miR-3151 is an independent prognostic factor in younger patients with cytogenetic intermediate-risk acute myeloid leukemia.
26050649 2015 BAALC potentiates oncogenic ERK pathway through interactions with MEKK1 and KLF4.
26012361 2015 Combined assessment of WT1 and BAALC gene expression at diagnosis may improve leukemia-free survival prediction in patients with myelodysplastic syndromes.
25428390 2015 Overexpression of BAALC: clinical significance in Chinese de novo acute myeloid leukemia.
24855032 2014 Low MDR1 and BAALC expression identifies a new subgroup of intermediate cytogenetic risk acute myeloid leukemia with a favorable outcome.
24736457 2014 Intronic miR-3151 within BAALC drives leukemogenesis by deregulating the TP53 pathway.
23865362 2013 Prognostic implication of BAALC gene expression in adult acute myeloid leukemia.
23760853 2013 BAALC overexpression retains its negative prognostic role across all cytogenetic risk groups in acute myeloid leukemia patients.
23672350 2013 BAALC and WT1 expressions from diagnosis to hematopoietic stem cell transplantation: consecutive monitoring in adult patients with core-binding-factor-positive AML.
More...