Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q8WXQ3
Symbols C14orf183

Gene

 Compartment GO Term (0)

AA Sequence

MEVLGFSNSKMDVRAKRQLEIWMEMAPSKPEPQGKAQQSQPTSVLSAANAAQRGKCCCCREGHSPEDYGR      1 - 70
QWAENVENHPEVAAHTSCLQSITPHFIAGEMGCTAKESQEQVPASITQILRNPWFSRLDSPRSRCLHLAS     71 - 140
SVDPIPGLQFFIVIVSDHQKVDREEEWKQGKIRKEIHWIPLFTMWSWLQCVEDRSIAGIPKLEHGDSHQT    141 - 210
ESLLDVLVGGFWGVPHTAPPRLQEAGGPTGGCGVGGQPLGGRGQWVGEETGPVGGPHAWWVPPTAPGTSL    211 - 280
VLLVLLAQPFQSSEWMPVSSHTPPGTQTNTAALLNVCTSYSEYV                              281 - 324
//

Publication (3)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.