Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 1.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
acute quadriplegic myopathy -1.283 1.1e-07
atypical teratoid / rhabdoid tumor 1.300 1.0e-02
medulloblastoma, large-cell 1.600 1.1e-03
ovarian cancer 1.600 3.6e-10

Gene RIF (1)

AA Sequence

MNLMDITKIFSLLQPDKEEEDTDTEEKQALNQAVYDNDSYTLDQLLRQERYKRFINSRSGWGVPGTPLRL      1 - 70
AASYGHLSCLQVLLAHGADVDSLDVKAQTPLFTAVSHGHLDCVRVLLEAGASPGGSIYNNCSPVLTAARD     71 - 140
GAVAILQELLDHGAEANVKAKLPVWASNIASCSGPLYLAAVYGHLDCFRLLLLHGADPDYNCTDQGLLAR    141 - 210
VPRPRTLLEICLHHNCEPEYIQLLIDFGANIYLPSLSLDLTSQDDKGIALLLQARATPRSLLSQVRLVVR    211 - 280
RALCQAGQPQAINQLDIPPMLISYLKHQL                                             281 - 309
//

Text Mined References (8)

PMID Year Title