Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.14
PubTator Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
lung carcinoma 1.600 1.1e-27
malignant mesothelioma -1.900 3.2e-07
osteosarcoma -1.086 9.0e-05
ovarian cancer 1.100 2.3e-04
pancreatic ductal adenocarcinoma liver m... -1.015 5.8e-03
psoriasis 1.700 7.7e-05
subependymal giant cell astrocytoma -1.010 1.8e-02
tuberculosis 1.700 2.3e-07
ulcerative colitis -1.200 1.1e-06

Gene RIF (1)

AA Sequence

MEPRAADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIESGACVNQVTVDSITPLHAASLQGQARCVQL      1 - 70
LLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASPLHEACMSGSSECVRLLIDVG     71 - 140
ANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAKLHETALHHAAKVKNVDLIEMLIEFGGNIYA    141 - 210
RDNRGKKPSDYTWSSSAPAKCFEYYEKTPLTLSQLCRVNLRKATGVRGLEKIAKLNIPPRLIDYLSYN      211 - 278
//

Text Mined References (12)

PMID Year Title