Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.05
PubTator Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 1.10686107734088E-27
tuberculosis and treatment for 3 months 327 1.42184775682816E-7
malignant mesothelioma 3163 3.22679191486636E-7
ulcerative colitis 2087 1.12314811423478E-6
psoriasis 6685 7.68462445861366E-5
osteosarcoma 7933 8.98926280058477E-5
ovarian cancer 8492 2.30953979414652E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00580272947874586
subependymal giant cell astrocytoma 2287 0.0175751124643489

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -1.900 0.000
psoriasis 1.700 0.000
osteosarcoma -1.086 0.000
tuberculosis and treatment for 3 months 1.800 0.000
pancreatic ductal adenocarcinoma liver m... -1.015 0.006
subependymal giant cell astrocytoma -1.010 0.018
lung carcinoma 1.600 0.000
ulcerative colitis -1.200 0.000
ovarian cancer 1.100 0.000

Synonym

Accession Q8WXK3 A8K7Q6 D3DRR2 Q96EP7 Q9H8Z1 ASB-13
Symbols

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
20677014 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEPRAADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIESGACVNQVTVDSITPLHAASLQGQARCVQL      1 - 70
LLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASPLHEACMSGSSECVRLLIDVG     71 - 140
ANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAKLHETALHHAAKVKNVDLIEMLIEFGGNIYA    141 - 210
RDNRGKKPSDYTWSSSAPAKCFEYYEKTPLTLSQLCRVNLRKATGVRGLEKIAKLNIPPRLIDYLSYN      211 - 278
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
16325183 2005 ASB proteins interact with Cullin5 and Rbx2 to form E3 ubiquitin ligase complexes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...