Property Summary

NCBI Gene PubMed Count 6
PubMed Score 6.19
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma, Renal Cell 124 0.0 0.0
Disease Target Count
Renal Cell Carcinoma 214
Disease Target Count P-value
lung carcinoma 2843 4.1e-15
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 2.1
Disease Target Count Z-score Confidence
Retinitis pigmentosa 11 59 4.316 2.2

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma 2.000 4.1e-15

Gene RIF (2)

AA Sequence

MDTNDDPDEDHLTSYDIQLSIQESIEASKTALCPERFVPLSAQNRKLVEAIKQGHIPELQEYVKYKYAMD      1 - 70
EADEKGWFPLHEAVVQPIQQILEIVLDASYKTLWEFKTCDGETPLTLAVKAGLVENVRTLLEKGVWPNTK     71 - 140
NDKGETPLLIAVKKGSYDMVSTLIKHNTSLDQPCVKRWSAMHEAAKQGRKDIVALLLKHGGNVHLRDGFG    141 - 210
VTPLGVAAEYGHCDVLEHLIHKGGDVLALADDGASVLFEAAGGGNPDCISLLLEYGGSGNVPNRAGHLPI    211 - 280
HRAAYEGHYLALKYLIPVTSKNAIRKSGLTPIHSAADGQNAQCLELLIENGFDVNTLLADHISQSYDDER    281 - 350
KTALYFGVSNNDVHCTEVLLAAGADPNLDPLNCLLVAVRANNYEIVRLLLSHGANVNCYFMHVNDTRFPS    351 - 420
VIQYALNDEVMLRLLLNNGYQVEMCFDCMHGDIFGNSFVWSEIQEEVLPGWTSCVIKDNPFCEFITVPWM    421 - 490
KHLVGRVTRVLIDYMDYVPLCAKLKSALEVQREWPEIRQILENPCSLKHLCRLKIRRLMGLQKLCQPASV    491 - 560
EKLPLPPAIQRYILFKEYDLYGQELKLT                                              561 - 588
//

Text Mined References (9)

PMID Year Title