Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.22
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Malaria 140 2.0

Gene RIF (1)

PMID Text
15204681 expressed exclusively in testis

AA Sequence

MSKSTKLCGKTSCPRSNIFCNLLDKIVKRPSLQFLGQWGYHCYEPRIYRSLAKILRYVDLDGFDALLTDY      1 - 70
IAFVEKSGYRFEVSFNLDFTEICVNTILYWVFARKGNPDFVELLLKKTKDYVQDRSCNLALIWRTFTPVY     71 - 140
CPSPLSGITPLFYVAQTRQSNIFKILLQYGILEREKNPINIVLTIVLYPSRVRVMVDRELADIHEDAKTC    141 - 210
LVLCSRVLSVISVKEIKTQLSLGRHPIISNWFDYIPSTRYKDPCELLHLCRLTIRNQLLTNNMLPDGIFS    211 - 280
LLIPARLQNYLNLEI                                                           281 - 295
//

Publication (8)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16325183 2005 ASB proteins interact with Cullin5 and Rbx2 to form E3 ubiquitin ligase complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15204681 Expression of testis specific ankyrin repeat and SOCS box-containing 17 gene.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12076535 2002 The SOCS box: a tale of destruction and degradation.