Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.22
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
lung cancer 4740 0.0 0.5
Disease Target Count Z-score Confidence
Malaria 160 0.0 2.1

Expression

Gene RIF (1)

AA Sequence

MSKSTKLCGKTSCPRSNIFCNLLDKIVKRPSLQFLGQWGYHCYEPRIYRSLAKILRYVDLDGFDALLTDY      1 - 70
IAFVEKSGYRFEVSFNLDFTEICVNTILYWVFARKGNPDFVELLLKKTKDYVQDRSCNLALIWRTFTPVY     71 - 140
CPSPLSGITPLFYVAQTRQSNIFKILLQYGILEREKNPINIVLTIVLYPSRVRVMVDRELADIHEDAKTC    141 - 210
LVLCSRVLSVISVKEIKTQLSLGRHPIISNWFDYIPSTRYKDPCELLHLCRLTIRNQLLTNNMLPDGIFS    211 - 280
LLIPARLQNYLNLEI                                                           281 - 295
//

Text Mined References (8)

PMID Year Title