Property Summary

NCBI Gene PubMed Count 28
PubMed Score 9.37
PubTator Score 12.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.500 4.5e-04
atypical teratoid / rhabdoid tumor -1.500 4.3e-05
glioblastoma -1.400 5.1e-03
group 4 medulloblastoma 1.100 3.5e-03
medulloblastoma, large-cell -1.600 1.4e-04
subependymal giant cell astrocytoma -1.773 1.7e-02

Protein-protein Interaction (13)

Gene RIF (7)

AA Sequence

MDRMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLKRKDLANLEVPHELPTKQDGS      1 - 70
GVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSARRSEPERGRLTPSPDIIVLSDNEASSPRSSS     71 - 140
RMEERLKAANLEMFKGKGIEERQQLIKQLRDELRLEEARLVLLKKLRQSQLQKENVVQKTPVVQNAASIV    141 - 210
QPSPAHVGQQGLSKLPSRPGAQGVEPQNLRTLQGHSVIRSATNTTLPHMLMSQRVIAPNPAQLQGQRGPP    211 - 280
KPGLVRTTTPNMNPAINYQPQSSSSVPCQRTTSSAIYMNLASHIQPGTVNRVSSPLPSPSAMTDAANSQA    281 - 350
AAKLALRKQLEKTLLEIPPPKPPAPLLHFLPSAANSEFIYMVGLEEVVQSVIDSQGKSCASLLRVEPFVC    351 - 420
AQCRTDFTPHWKQEKNGKILCEQCMTSNQKKALKAEHTNRLKNAFVKALQQEQEIEQRLQQQAALSPTTA    421 - 490
PAVSSVSKQETIMRHHTLRQAPQPQSSLQRGIPTSARSMLSNFAQAPQLSVPGGLLGMPGVNIAYLNTGI    491 - 560
GGHKGPSLADRQREYLLDMIPPRSISQSISGQK                                         561 - 593
//

Text Mined References (41)

PMID Year Title