Property Summary

NCBI Gene PubMed Count 23
PubMed Score 7.48
PubTator Score 12.83

Knowledge Summary


No data available


  Disease Sources (4)


  Differential Expression (6)


Accession Q8WXI9 D3DUZ2 Q5VUR2 Q7LG68 Q9ULS0
Symbols p68


  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (4)

25118846 p66beta might be important for the regulation of LOX in the nucleus.
23644463 Detailed clinical description showed that all four individuals with a GATAD2B aberration had a distinctive phenotype with childhood hypotonia, severe intellectual disability.
18505370 Observational study of gene-disease association. (HuGE Navigator)
12183469 identification as potent transcriptional repressors interacting with MBD2 and MBD3

AA Sequence

GGHKGPSLADRQREYLLDMIPPRSISQSISGQK                                         561 - 593

Text Mined References (35)

PMID Year Title
25796366 2015 Structure and function insights into the NuRD chromatin remodeling complex.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25416956 2014 A proteome-scale map of the human interactome network.
25356899 2014 De novo mutations in moderate or severe intellectual disability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25123934 2015 Towards elucidating the stability, dynamics and architecture of the nucleosome remodeling and deacetylase complex by using quantitative interaction proteomics.
25118846 2014 Nuclear translocation of lysyl oxidase is promoted by interaction with transcription repressor p66?.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23644463 2013 GATAD2B loss-of-function mutations cause a recognisable syndrome with intellectual disability and are associated with learning deficits and synaptic undergrowth in Drosophila.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.