Property Summary

NCBI Gene PubMed Count 8
Grant Count 46
R01 Count 6
Funding $11,113,853.41
PubMed Score 21.45
PubTator Score 100.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -3.952 0.000
tuberculosis 1.300 0.005
mucosa-associated lymphoid tissue lympho... 2.398 0.025
psoriasis 3.300 0.000

Gene RIF (3)

PMID Text
24101491 Results show the molecular mechanism of glycolipid recognition through C-type lectin receptors, which may provide clues to rational design for effective adjuvants.
22689578 CLECSF8 functions as an activation receptor on myeloid cells and associates with a novel adaptor molecule
14971047 Cross-linking of the receptor leads to a rapid internalization suggesting that CLECSF8 constitutes and endocytic receptor.

AA Sequence

MGLEKPQSKLEGGMHPQLIPSVIAVVFILLLSVCFIASCLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEK      1 - 70
SELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLS     71 - 140
YFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIP    141 - 210
GTTLN                                                                     211 - 215
//

Publication (9)

PMID Year Title
24101491 2013 Structural analysis for glycolipid recognition by the C-type lectins Mincle and MCL.
22689578 2012 The C-type lectin receptor CLECSF8 (CLEC4D) is expressed by myeloid cells and triggers cellular activation through Syk kinase.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15368084 2004 Identification of lectin-like receptors expressed by antigen presenting cells and neutrophils and their mapping to a novel gene complex.
14971047 2004 The human C-type lectin CLECSF8 is a novel monocyte/macrophage endocytic receptor.
12945048 2003 Evolutionary analysis reveals collective properties and specificity in the C-type lectin and lectin-like domain superfamily.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10508765 1999 C-type lectin-like domains.