Property Summary

NCBI Gene PubMed Count 8
PubMed Score 21.45
PubTator Score 100.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Lung diseases 48
Disease Target Count P-value
psoriasis 6685 1.21221034240856E-38
osteosarcoma 7933 1.1820175570595E-6
tuberculosis 1563 0.00457702685755391
mucosa-associated lymphoid tissue lymphoma 480 0.024999839994785

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -3.952 0.000
tuberculosis 1.300 0.005
mucosa-associated lymphoid tissue lympho... 2.398 0.025
psoriasis 3.300 0.000

Synonym

Accession Q8WXI8 Q8N5J5
Symbols MCL
MPCL
CD368
CLEC6
CLEC-6
CLECSF8

Gene

PDB

2LS8   3WHD  

  Ortholog (4)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid

Gene RIF (3)

PMID Text
24101491 Results show the molecular mechanism of glycolipid recognition through C-type lectin receptors, which may provide clues to rational design for effective adjuvants.
22689578 CLECSF8 functions as an activation receptor on myeloid cells and associates with a novel adaptor molecule
14971047 Cross-linking of the receptor leads to a rapid internalization suggesting that CLECSF8 constitutes and endocytic receptor.

AA Sequence

MGLEKPQSKLEGGMHPQLIPSVIAVVFILLLSVCFIASCLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEK      1 - 70
SELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLS     71 - 140
YFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIP    141 - 210
GTTLN                                                                     211 - 215
//

Text Mined References (9)

PMID Year Title
24101491 2013 Structural analysis for glycolipid recognition by the C-type lectins Mincle and MCL.
22689578 2012 The C-type lectin receptor CLECSF8 (CLEC4D) is expressed by myeloid cells and triggers cellular activation through Syk kinase.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15368084 2004 Identification of lectin-like receptors expressed by antigen presenting cells and neutrophils and their mapping to a novel gene complex.
14971047 2004 The human C-type lectin CLECSF8 is a novel monocyte/macrophage endocytic receptor.
12945048 2003 Evolutionary analysis reveals collective properties and specificity in the C-type lectin and lectin-like domain superfamily.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10508765 1999 C-type lectin-like domains.