Property Summary

NCBI Gene PubMed Count 14
PubMed Score 204.46
PubTator Score 24.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
active Crohn's disease -1.205 7.0e-03
active ulcerative colitis -1.496 1.3e-02
interstitial cystitis -1.200 1.5e-02
intraductal papillary-mucinous adenoma (... 1.100 1.2e-03
intraductal papillary-mucinous carcinoma... 1.300 4.5e-04
intraductal papillary-mucinous neoplasm ... 1.400 1.3e-03
lung adenocarcinoma 1.300 4.7e-07
lung cancer 1.500 1.1e-03
medulloblastoma, large-cell -1.200 1.1e-03
osteosarcoma -1.159 1.1e-03
psoriasis -1.600 5.9e-04

Protein-protein Interaction (1)

Gene RIF (5)

AA Sequence

MIQNVGNHLRRGLASVFSNRTSRKSALRAGNDSAMADGEGYRNPTEVQMSQLVLPCHTNQRGELSVGQLL      1 - 70
KWIDTTACLSAERHAGCPCVTASMDDIYFEHTISVGQVVNIKAKVNRAFNSSMEVGIQVASEDLCSEKQW     71 - 140
NVCKALATFVARREITKVKLKQITPRTEEEKMEHSVAAERRRMRLVYADTIKDLLANCAIQGDLESRDCS    141 - 210
RMVPAEKTRVESVELVLPPHANHQGNTFGGQIMAWMENVATIAASRLCRAHPTLKAIEMFHFRGPSQVGD    211 - 280
RLVLKAIVNNAFKHSMEVGVCVEAYRQEAETHRRHINSAFMTFVVLDADDQPQLLPWIRPQPGDGERRYR    281 - 350
EASARKKIRLDRKYIVSCKQTEVPLSVPWDPSNQVYLSYNNVSSLKMLVAKDNWVLSSEISQVRLYTLED    351 - 420
DKFLSFHMEMVVHVDAAQAFLLLSDLRQRPEWDKHYRSVELVQQVDEDDAIYHVTSPALGGHTKPQDFVI    421 - 490
LASRRKPCDNGDPYVIALRSVTLPTHRETPEYRRGETLCSGFCLWREGDQLTKCCWVRVSLTELVSASGF    491 - 560
YSWGLESRSKGRRSDGWNGKLAGGHLSTLKAIPVAKINSRFGYLQDT                           561 - 607
//

Text Mined References (16)

PMID Year Title