Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.76
PubTator Score 10.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Glaucoma 1, Open Angle, F 1 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 8.5e-05
Disease Target Count Z-score Confidence
Glaucoma 239 4.733 2.4

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.020 8.5e-05

Gene RIF (6)

AA Sequence

MLMSWSPEECKGQGEPLDDRHPLCARLVEKPSRGSEEHLKSGPGPIVTRTASGPALAFWQAVLAGDVGCV      1 - 70
SRILADSSTGLAPDSVFDTSDPERWRDFRFNIRALRLWSLTYEEELTTPLHVAASRGHTEVLRLLLRRRA     71 - 140
RPDSAPGGRTALHEACAAGHTACVHVLLVAGADPNIADQDGKRPLHLCRGPGTLECAELLLRFGARVDGR    141 - 210
SEEEEETPLHVAARLGHVELADLLLRRGACPDARNAEGWTPLLAACDVRCQSITDAEATTARCLQLCSLL    211 - 280
LSAGADADAADQDKQRPLHLACRRGHAAVVELLLSCGVSANTMDYGGHTPLHCALQGPAAALAQSPEHVV    281 - 350
RALLNHGAVRVWPGALPKVLERWSTCPRTIEVLMNTYSVVQLPEEAVGLVTPETLQKHQRFYSSLFALVR    351 - 420
QPRSLQHLSRCALRSHLEGSLPQALPRLPLPPRLLRYLQLDFEGVLY                           421 - 467
//

Text Mined References (13)

PMID Year Title