Property Summary

NCBI Gene PubMed Count 25
PubMed Score 13.71
PubTator Score 7.75

Knowledge Summary

Patent

No data available

Expression

Gene

PANTHER Protein Class (2)

PDB

2EAN   3BS5  

Gene RIF (4)

PMID Text
25754917 CNKSR2 deletions: a novel cause of X-linked intellectual disability and seizures.
25223753 This study describes the phenotype of CNKSR2 deficiency and its involvement in systems underlying common neurological
18287031 CNK and HYP form a discrete dimer by their SAM domains to mediate RAF kinase signaling.
14597674 CNK2 through interaction with Raf and Rlf may function as a regulator of Ras signaling.

AA Sequence

MALIMEPVSKWSPSQVVDWMKGLDDCLQQYIKNFEREKISGDQLLRITHQELEDLGVSRIGHQELILEAV      1 - 70
DLLCALNYGLETENLKTLSHKLNASAKNLQNFITGRRRSGHYDGRTSRKLPNDFLTSVVDLIGAAKSLLA     71 - 140
WLDRSPFAAVTDYSVTRNNVIQLCLELTTIVQQDCTVYETENKILHVCKTLSGVCDHIISLSSDPLVSQS    141 - 210
AHLEVIQLANIKPSEGLGMYIKSTYDGLHVITGTTENSPADRCKKIHAGDEVIQVNHQTVVGWQLKNLVN    211 - 280
ALREDPSGVILTLKKRPQSMLTSAPALLKNMRWKPLALQPLIPRSPTSSVATPSSTISTPTKRDSSALQD    281 - 350
LYIPPPPAEPYIPRDEKGNLPCEDLRGHMVGKPVHKGSESPNSFLDQEYRKRFNIVEEDTVLYCYEYEKG    351 - 420
RSSSQGRRESTPTYGKLRPISMPVEYNWVGDYEDPNKMKRDSRRENSLLRYMSNEKIAQEEYMFQRNSKK    421 - 490
DTGKKSKKKGDKSNSPTHYSLLPSLQMDALRQDIMGTPVPETTLYHTFQQSSLQHKSKKKNKGPIAGKSK    491 - 560
RRISCKDLGRGDCEGWLWKKKDAKSYFSQKWKKYWFVLKDASLYWYINEEDEKAEGFISLPEFKIDRASE    561 - 630
CRKKYAFKACHPKIKSFYFAAEHLDDMNRWLNRINMLTAGYAERERIKQEQDYWSESDKEEADTPSTPKQ    631 - 700
DSPPPPYDTYPRPPSMSCASPYVEAKHSRLSSTETSQSQSSHEEFRQEVTGSSAVSPIRKTASQRRSWQD    701 - 770
LIETPLTSSGLHYLQTLPLEDSVFSDSAAISPEHRRQSTLPTQKCHLQDHYGPYPLAESERMQVLNGNGG    771 - 840
KPRSFTLPRDSGFNHCCLNAPVSACDPQDDVQPPEVEEEEEEEEEEGEAAGENIGEKSESREEKLGDSLQ    841 - 910
DLYRALEQASLSPLGEHRISTKMEYKLSFIKRCNDPVMNEKLHRLRILKSTLKAREGEVAIIDKVLDNPD    911 - 980
LTSKEFQQWKQMYLDLFLDICQNTTSNDPLSISSEVDVITSSLAHTHSYIETHV                    981 - 1034
//

Publication (29)

PMID Year Title
25754917 2015 CNKSR2 deletions: a novel cause of X-linked intellectual disability and seizures.
25223753 2014 Absent CNKSR2 causes seizures and intellectual, attention, and language deficits.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24656827 2014 The CNK2 scaffold interacts with vilse and modulates Rac cycling during spine morphogenesis in hippocampal neurons.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24184104 2013 The kinases LF4 and CNK2 control ciliary length by feedback regulation of assembly and disassembly rates.
22511892 2012 Loss-of-Function CNKSR2 Mutation Is a Likely Cause of Non-Syndromic X-Linked Intellectual Disability.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19563921 2009 Proteomic characterization of the dynamic KSR-2 interactome, a signaling scaffold complex in MAPK pathway.
More...