Property Summary

NCBI Gene PubMed Count 25
PubMed Score 13.71
PubTator Score 7.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
psoriasis 6685 5.33058981748271E-44
ependymoma 2514 5.28365782122657E-20
lung adenocarcinoma 2714 2.30149534426545E-18
medulloblastoma 1524 3.86544218995351E-14
atypical teratoid / rhabdoid tumor 4369 5.58091567198454E-12
ovarian cancer 8492 1.34982264554401E-11
glioblastoma 5572 1.03505297940395E-10
pilocytic astrocytoma 3086 4.18699971205975E-8
medulloblastoma, large-cell 6234 4.73923436625179E-8
primitive neuroectodermal tumor 3031 5.42846838825489E-8
pediatric high grade glioma 2712 7.16831343807227E-7
Atopic dermatitis 944 7.01273387005647E-6
ductal carcinoma in situ 1745 0.0017819217450347
astrocytic glioma 2241 0.00194844543052003
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00199578166092789
invasive ductal carcinoma 2950 0.00245651632728749
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00305120107375883
subependymal giant cell astrocytoma 2287 0.00471978450057554
oligodendroglioma 2849 0.00482760093028873
Pick disease 1893 0.0146764868189299
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0159150897510907
Breast cancer 3099 0.0262596454803882
acute quadriplegic myopathy 1157 0.0297564275671491
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Intellectual disability 573 3.445 1.7

Expression

Gene

PANTHER Protein Class (2)

PDB

2EAN   3BS5  

  Ortholog (14)

Gene RIF (4)

PMID Text
25754917 CNKSR2 deletions: a novel cause of X-linked intellectual disability and seizures.
25223753 This study describes the phenotype of CNKSR2 deficiency and its involvement in systems underlying common neurological
18287031 CNK and HYP form a discrete dimer by their SAM domains to mediate RAF kinase signaling.
14597674 CNK2 through interaction with Raf and Rlf may function as a regulator of Ras signaling.

AA Sequence

MALIMEPVSKWSPSQVVDWMKGLDDCLQQYIKNFEREKISGDQLLRITHQELEDLGVSRIGHQELILEAV      1 - 70
DLLCALNYGLETENLKTLSHKLNASAKNLQNFITGRRRSGHYDGRTSRKLPNDFLTSVVDLIGAAKSLLA     71 - 140
WLDRSPFAAVTDYSVTRNNVIQLCLELTTIVQQDCTVYETENKILHVCKTLSGVCDHIISLSSDPLVSQS    141 - 210
AHLEVIQLANIKPSEGLGMYIKSTYDGLHVITGTTENSPADRCKKIHAGDEVIQVNHQTVVGWQLKNLVN    211 - 280
ALREDPSGVILTLKKRPQSMLTSAPALLKNMRWKPLALQPLIPRSPTSSVATPSSTISTPTKRDSSALQD    281 - 350
LYIPPPPAEPYIPRDEKGNLPCEDLRGHMVGKPVHKGSESPNSFLDQEYRKRFNIVEEDTVLYCYEYEKG    351 - 420
RSSSQGRRESTPTYGKLRPISMPVEYNWVGDYEDPNKMKRDSRRENSLLRYMSNEKIAQEEYMFQRNSKK    421 - 490
DTGKKSKKKGDKSNSPTHYSLLPSLQMDALRQDIMGTPVPETTLYHTFQQSSLQHKSKKKNKGPIAGKSK    491 - 560
RRISCKDLGRGDCEGWLWKKKDAKSYFSQKWKKYWFVLKDASLYWYINEEDEKAEGFISLPEFKIDRASE    561 - 630
CRKKYAFKACHPKIKSFYFAAEHLDDMNRWLNRINMLTAGYAERERIKQEQDYWSESDKEEADTPSTPKQ    631 - 700
DSPPPPYDTYPRPPSMSCASPYVEAKHSRLSSTETSQSQSSHEEFRQEVTGSSAVSPIRKTASQRRSWQD    701 - 770
LIETPLTSSGLHYLQTLPLEDSVFSDSAAISPEHRRQSTLPTQKCHLQDHYGPYPLAESERMQVLNGNGG    771 - 840
KPRSFTLPRDSGFNHCCLNAPVSACDPQDDVQPPEVEEEEEEEEEEGEAAGENIGEKSESREEKLGDSLQ    841 - 910
DLYRALEQASLSPLGEHRISTKMEYKLSFIKRCNDPVMNEKLHRLRILKSTLKAREGEVAIIDKVLDNPD    911 - 980
LTSKEFQQWKQMYLDLFLDICQNTTSNDPLSISSEVDVITSSLAHTHSYIETHV                    981 - 1034
//

Text Mined References (29)

PMID Year Title
25754917 2015 CNKSR2 deletions: a novel cause of X-linked intellectual disability and seizures.
25223753 2014 Absent CNKSR2 causes seizures and intellectual, attention, and language deficits.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24656827 2014 The CNK2 scaffold interacts with vilse and modulates Rac cycling during spine morphogenesis in hippocampal neurons.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24184104 2013 The kinases LF4 and CNK2 control ciliary length by feedback regulation of assembly and disassembly rates.
22511892 2012 Loss-of-Function CNKSR2 Mutation Is a Likely Cause of Non-Syndromic X-Linked Intellectual Disability.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19563921 2009 Proteomic characterization of the dynamic KSR-2 interactome, a signaling scaffold complex in MAPK pathway.
More...