Property Summary

NCBI Gene PubMed Count 25
PubMed Score 14.53
PubTator Score 7.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute quadriplegic myopathy -1.174 3.0e-02
adult high grade glioma -1.500 2.4e-02
astrocytic glioma -3.300 1.9e-03
Astrocytoma, Pilocytic -1.300 7.2e-03
Atopic dermatitis -2.500 7.0e-06
atypical teratoid / rhabdoid tumor -1.600 1.4e-03
Breast cancer -1.500 2.6e-02
ductal carcinoma in situ -1.700 1.8e-03
ependymoma -1.400 3.4e-02
glioblastoma -1.300 1.1e-03
group 3 medulloblastoma -2.800 2.6e-02
intraductal papillary-mucinous adenoma (... -1.600 3.1e-03
intraductal papillary-mucinous carcinoma... -1.800 2.0e-03
intraductal papillary-mucinous neoplasm ... -1.900 1.6e-02
invasive ductal carcinoma -2.200 2.5e-03
lung adenocarcinoma -1.100 2.3e-18
medulloblastoma, large-cell -1.600 3.7e-05
oligodendroglioma -3.200 4.8e-03
ovarian cancer -2.800 1.3e-11
Pick disease -1.300 6.7e-03
primitive neuroectodermal tumor -1.700 3.1e-04
psoriasis -1.300 4.0e-20
subependymal giant cell astrocytoma -2.843 4.7e-03

Gene RIF (4)

AA Sequence

MALIMEPVSKWSPSQVVDWMKGLDDCLQQYIKNFEREKISGDQLLRITHQELEDLGVSRIGHQELILEAV      1 - 70
DLLCALNYGLETENLKTLSHKLNASAKNLQNFITGRRRSGHYDGRTSRKLPNDFLTSVVDLIGAAKSLLA     71 - 140
WLDRSPFAAVTDYSVTRNNVIQLCLELTTIVQQDCTVYETENKILHVCKTLSGVCDHIISLSSDPLVSQS    141 - 210
AHLEVIQLANIKPSEGLGMYIKSTYDGLHVITGTTENSPADRCKKIHAGDEVIQVNHQTVVGWQLKNLVN    211 - 280
ALREDPSGVILTLKKRPQSMLTSAPALLKNMRWKPLALQPLIPRSPTSSVATPSSTISTPTKRDSSALQD    281 - 350
LYIPPPPAEPYIPRDEKGNLPCEDLRGHMVGKPVHKGSESPNSFLDQEYRKRFNIVEEDTVLYCYEYEKG    351 - 420
RSSSQGRRESTPTYGKLRPISMPVEYNWVGDYEDPNKMKRDSRRENSLLRYMSNEKIAQEEYMFQRNSKK    421 - 490
DTGKKSKKKGDKSNSPTHYSLLPSLQMDALRQDIMGTPVPETTLYHTFQQSSLQHKSKKKNKGPIAGKSK    491 - 560
RRISCKDLGRGDCEGWLWKKKDAKSYFSQKWKKYWFVLKDASLYWYINEEDEKAEGFISLPEFKIDRASE    561 - 630
CRKKYAFKACHPKIKSFYFAAEHLDDMNRWLNRINMLTAGYAERERIKQEQDYWSESDKEEADTPSTPKQ    631 - 700
DSPPPPYDTYPRPPSMSCASPYVEAKHSRLSSTETSQSQSSHEEFRQEVTGSSAVSPIRKTASQRRSWQD    701 - 770
LIETPLTSSGLHYLQTLPLEDSVFSDSAAISPEHRRQSTLPTQKCHLQDHYGPYPLAESERMQVLNGNGG    771 - 840
KPRSFTLPRDSGFNHCCLNAPVSACDPQDDVQPPEVEEEEEEEEEEGEAAGENIGEKSESREEKLGDSLQ    841 - 910
DLYRALEQASLSPLGEHRISTKMEYKLSFIKRCNDPVMNEKLHRLRILKSTLKAREGEVAIIDKVLDNPD    911 - 980
LTSKEFQQWKQMYLDLFLDICQNTTSNDPLSISSEVDVITSSLAHTHSYIETHV                    981 - 1034
//

Text Mined References (29)

PMID Year Title