Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.56
PubTator Score 4.61

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MSAPGSPDQAYDFLLKFLLVGDRDVGKSEILESLQDGAAESPYSHLGGIDYKTTTILLDGQRVKLKLWDT      1 - 70
SGQGRFCTIFRSYSRGAQGVILVYDIANRWSFEGMDRWIKKIEEHAPGVPKILVGNRLHLAFKRQVPREQ     71 - 140
AQAYAERLGVTFFEVSPLCNFNIIESFTELARIVLLRHRMNWLGRPSKVLSLQDLCCRTIVSCTPVHLVD    141 - 210
KLPLPSTLRSHLKSFSMAKGLNARMMRGLSYSLTTSSTHKSSLCKVEIVCPPQSPPKNCTRNSCKIS       211 - 277
//

Text Mined References (9)

PMID Year Title