Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.56
PubTator Score 4.61

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8WXH6 O00407 Q17RQ5 Q6DK06 Q8TF06
Symbols RAR2
RAR2A

Gene

  Ortholog (1)

Species Source
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
25496667 Genome-wide shRNA screening identifies RAB40A, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells

AA Sequence

MSAPGSPDQAYDFLLKFLLVGDRDVGKSEILESLQDGAAESPYSHLGGIDYKTTTILLDGQRVKLKLWDT      1 - 70
SGQGRFCTIFRSYSRGAQGVILVYDIANRWSFEGMDRWIKKIEEHAPGVPKILVGNRLHLAFKRQVPREQ     71 - 140
AQAYAERLGVTFFEVSPLCNFNIIESFTELARIVLLRHRMNWLGRPSKVLSLQDLCCRTIVSCTPVHLVD    141 - 210
KLPLPSTLRSHLKSFSMAKGLNARMMRGLSYSLTTSSTHKSSLCKVEIVCPPQSPPKNCTRNSCKIS       211 - 277
//

Text Mined References (9)

PMID Year Title
16923123 2006 Screening for target Rabs of TBC (Tre-2/Bub2/Cdc16) domain-containing proteins based on their Rab-binding activity.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12578829 2003 Distinct Rab binding specificity of Rim1, Rim2, rabphilin, and Noc2. Identification of a critical determinant of Rab3A/Rab27A recognition by Rim2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12076535 2002 The SOCS box: a tale of destruction and degradation.
11773082 2002 The Slp homology domain of synaptotagmin-like proteins 1-4 and Slac2 functions as a novel Rab27A binding domain.
11697911 2001 Evolution of the Rab family of small GTP-binding proteins.