Property Summary

NCBI Gene PubMed Count 20
PubMed Score 14.82
PubTator Score 8.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Precancerous Conditions 80 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 2.1e-05
glioblastoma 1.100 2.0e-03
group 4 medulloblastoma 1.200 3.3e-04
juvenile dermatomyositis 1.114 1.1e-10
medulloblastoma, large-cell 1.400 1.3e-04
ovarian cancer 1.200 1.1e-02

Gene RIF (13)

AA Sequence

MAENNENISKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESYSDAETVNGIEKTEVSLRNQERKHS      1 - 70
CSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPSKRKIHISELMLDKCPFPPRSDL     71 - 140
AFRWHFIKRHTAPINSKSDEWVSTDLSQTELRDGQLKRRNMEENINCFSHTNVQPCVITTDNALCREGPM    141 - 210
TGSVMNLVSNNSIEDSDMDSDDEILTLCTSSRKRNKPKWDLDDEILQLETPPKYHTQIDYVHCLVPDLLQ    211 - 280
INNNPCYWGVMDKYAAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPC    281 - 350
VFHSPDITGLLEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLK    351 - 420
EYHYKSKVRVLRIDAPEQQC                                                      421 - 440
//

Text Mined References (20)

PMID Year Title