Property Summary

NCBI Gene PubMed Count 19
Grant Count 1
Funding $29,960.7
PubMed Score 13.82
PubTator Score 8.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 0.000
glioblastoma 1.100 0.002
medulloblastoma 1.200 0.006
medulloblastoma, large-cell 1.400 0.000
juvenile dermatomyositis 1.114 0.000
ovarian cancer 1.200 0.011

Synonym

Accession Q8WXH5 SOCS-4
Symbols SOCS7

Gene

 Grant Application (1)

PDB

2IZV  

Gene RIF (12)

PMID Text
26437444 miR-25 promotes the migration and invasion of thyroid cancer cells by directly binding to the 3'-UTR of SOCS4 that leads to the inhibition of SOCS4.
25639832 SOCS4 is a known inhibitor of epidermal growth factor (EGF) receptor signalling, and functional studies demonstrated specific upregulation of EGF-dependent immune stimulation in affected family members.
25286386 This study showed that increased protein levels of SOCS-4 and SOCS-7 in Alzheimer's disease brains.
22423360 Identified is a conserved region of about 70 residues in the N-terminal domains of SOCS4 and 5 that is predicted to be more ordered than the surrounding sequence.
22127425 The expression of SOCS4 seems to be controlled epigenetically and is often weakly expressed in gastric cancer tissue and cell lines. SOCS4 methylation status could be a predictor of gastric cancer prognosis.
20486857 These data suggest that miRNAs play an important role in the regulation of cytokine-inducible Src homology and SOCS expression in epithelial cells in response to C. parvum infection.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20433750 Higher mRNA expression levels of SOCS1, 3, 4 and 7 are significantly associated with earlier tumour stage and better clinical outcome in human breast cancer.
20406964 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAENNENISKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESYSDAETVNGIEKTEVSLRNQERKHS      1 - 70
CSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPSKRKIHISELMLDKCPFPPRSDL     71 - 140
AFRWHFIKRHTAPINSKSDEWVSTDLSQTELRDGQLKRRNMEENINCFSHTNVQPCVITTDNALCREGPM    141 - 210
TGSVMNLVSNNSIEDSDMDSDDEILTLCTSSRKRNKPKWDLDDEILQLETPPKYHTQIDYVHCLVPDLLQ    211 - 280
INNNPCYWGVMDKYAAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPC    281 - 350
VFHSPDITGLLEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLK    351 - 420
EYHYKSKVRVLRIDAPEQQC                                                      421 - 440
//

Text Mined References (19)

PMID Year Title
26437444 2015 Interleukin-23 Facilitates Thyroid Cancer Cell Migration and Invasion by Inhibiting SOCS4 Expression via MicroRNA-25.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25639832 2015 A missense mutation underlies defective SOCS4 function in a family with autoimmunity.
25286386 2015 Expression of suppressor of cytokine signaling genes in human elderly and Alzheimer's disease brains and human microglia.
22423360 2012 The N-terminal domains of SOCS proteins: a conserved region in the disordered N-termini of SOCS4 and 5.
22127425 2012 Suppressor of cytokine signaling 4 detected as a novel gastric cancer suppressor gene using double combination array analysis.
20486857 2010 MicroRNA-98 and let-7 regulate expression of suppressor of cytokine signaling 4 in biliary epithelial cells in response to Cryptosporidium parvum infection.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20433750 2010 Higher expression levels of SOCS 1,3,4,7 are associated with earlier tumour stage and better clinical outcome in human breast cancer.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
More...