Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.27
PubTator Score 0.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
gastric carcinoma 807 3.4e-03
non diabetic and post-ischemic heart failure 200 1.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (2)

Disease log2 FC p
gastric carcinoma -1.100 3.4e-03
non diabetic and post-ischemic heart fai... 1.300 1.6e-02

Gene RIF (1)

AA Sequence

MEDGPVFYGFKNIFITMFATFFFFKLLIKVFLALLTHFYIVKGNRKEAARIAEEIYGGISDCWADRSPLH      1 - 70
EAAAQGRLLALKTLIAQGVNVNLVTINRVSSLHEACLGGHVACAKALLENGAHVNGVTVHGATPLFNACC     71 - 140
SGSAACVNVLLEFGAKAQLEVHLASPIHEAVKRGHRECMEILLANNVNIDHEVPQLGTPLYVACTYQRVD    141 - 210
CVKKLLELGASVDHGQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSVEQALLL    211 - 280
REGPPALSQLCRLCVRKCLGRACHQAIHKLHLPEPLERFLLYQ                               281 - 323
//

Text Mined References (9)

PMID Year Title