Property Summary

NCBI Gene PubMed Count 33
PubMed Score 34.75
PubTator Score 1294.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.800 1.6e-03
astrocytic glioma -1.800 9.6e-03
Astrocytoma, Pilocytic -1.700 2.3e-05
atypical teratoid / rhabdoid tumor -1.600 4.3e-09
ependymoma -3.200 2.6e-02
glioblastoma -1.600 3.3e-08
group 3 medulloblastoma -2.200 5.9e-03
medulloblastoma, large-cell -1.300 3.3e-03
oligodendroglioma -1.900 3.7e-09
primitive neuroectodermal tumor -1.400 3.0e-04
subependymal giant cell astrocytoma -1.345 4.9e-02

Gene RIF (18)

AA Sequence

MSSGGRFNFDDGGSYCGGWEDGKAHGHGVCTGPKGQGEYTGSWSHGFEVLGVYTWPSGNTYQGTWAQGKR      1 - 70
HGIGLESKGKWVYKGEWTHGFKGRYGVRECAGNGAKYEGTWSNGLQDGYGTETYSDGGTYQGQWVGGMRQ     71 - 140
GYGVRQSVPYGMAAVIRSPLRTSINSLRSEHTNGTALHPDASPAVAGSPAVSRGGFVLVAHSDSEILKSK    141 - 210
KKGLFRRSLLSGLKLRKSESKSSLASQRSKQSSFRSEAGMSTVSSTASDIHSTISLGEAEAELAVIEDDI    211 - 280
DATTTETYVGEWKNDKRSGFGVSQRSDGLKYEGEWASNRRHGYGCMTFPDGTKEEGKYKQNILVGGKRKN    281 - 350
LIPLRASKIREKVDRAVEAAERAATIAKQKAEIAASRTSHSRAKAEAALTAAQKAQEEARIARITAKEFS    351 - 420
PSFQHRENGLEYQRPKRQTSCDDIEVLSTGTPLQQESPELYRKGTTPSDLTPDDSPLQSFPTSPAATPPP    421 - 490
APAARNKVAHFSRQVSVDEERGGDIQMLLEGRAGDCARSSWGEEQAGGSRGVRSGALRGGLLVDDFRTRG    491 - 560
SGRKQPGNPKPRERRTESPPVFTWTSHHRASNHSPGGSRLLELQEEKLSNYRMEMKPLLRMETHPQKRRY    561 - 630
SKGGACRGLGDDHRPEDRGFGVQRLRSKAQNKENFRPASSAEPAVQKLASLRLGGAEPRLLRWDLTFSPP    631 - 700
QKSLPVALESDEENGDELKSSTGSAPILVVMVILLNIGVAILFINFFI                          701 - 748
//

Text Mined References (32)

PMID Year Title