Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.55
PubTator Score 2.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
osteosarcoma 7,933
tuberculosis 1,557

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.433 0.000
tuberculosis 1.800 0.000

Gene RIF (1)

PMID Text
19861958 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPTQLEMAMDTMIRIFHRYSGKERKRFKLSKGELKLLLQRELTEFLSCQKETQLVDKIVQDLDANKDNEV      1 - 70
DFNEFVVMVAALTVACNDYFVEQLKKKGK                                              71 - 99
//

Text Mined References (5)

PMID Year Title
19861958 2010 Genetic analysis in a Dutch study sample identifies more ulcerative colitis susceptibility loci and shows their additive role in disease risk.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11747429 2001 Molecular characterization and tissue distribution of a novel member of the S100 family of EF-hand proteins.