Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.71
PubTator Score 2.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
tuberculosis 2010 1.3e-06
osteosarcoma 7950 2.3e-05

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.433 2.3e-05
tuberculosis 1.800 1.3e-06

Gene RIF (1)

AA Sequence

MPTQLEMAMDTMIRIFHRYSGKERKRFKLSKGELKLLLQRELTEFLSCQKETQLVDKIVQDLDANKDNEV      1 - 70
DFNEFVVMVAALTVACNDYFVEQLKKKGK                                              71 - 99
//

Text Mined References (6)

PMID Year Title