Property Summary

NCBI Gene PubMed Count 51
Grant Count 24
R01 Count 18
Funding $2,560,649.69
PubMed Score 70.60
PubTator Score 72.74

Knowledge Summary


No data available


  Differential Expression (8)

Gene RIF (31)

26517243 miR-3151 silencing by DNA methylation protected chronic lymphocytic leukemia cells from apoptosis by over-expression of its direct targets MADD and PIK3R2, constitutive activation of MEK/ERK and PI3K/AKT signaling , and over-expression of MCL1.
24038283 Taken together, our data reveal that PTEN can convey the death signal by preventing MADD phosphorylation by Akt.
23457619 MADD knockdown resulted in enhanced spontaneous apoptosis in human breast cancer cell lines
23443411 These results suggest that MADD may be a potential therapeutic target for lung adenocarcinoma therapy involving the TRAIL-induced apoptosis pathway
22678883 We analyzed DENN/MADD/IG20 (DMI), the complex of four splice variants in Alzheimer's disease.
22529996 SNP rs2290149, located in a genetic cluster of MYBPC3 and MADD gene, was found to be associated with diastolic heart failure.
22482404 Data show that ehe expression of MAPK-activating death domain protein (MADD) increases obviously in lung adenocarcinoma, and MADD can promote survival of lung adenocarcinoma cells by inhibiting apoptosis.
21887289 The SNP in ADCY5 is implicated in defective proinsulin-to-insulin conversion and previous findings on the role of a genetic variant in MADD on proinsulin-to-insulin conversion, were confirmed.
21103350 Data show that SNPs from MADD, PROX1, and SLC30A8 were associated with type 2 diabetes.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

TPMAHEICYSVLCLFSYVAAVHSSEEDLRTPPRPVSS                                    1611 - 1647

Text Mined References (59)

PMID Year Title
26517243 2015 Epigenetic silencing of tumor suppressor miR-3151 contributes to Chinese chronic lymphocytic leukemia by constitutive activation of MADD/ERK and PIK3R2/AKT signaling pathways.
24038283 2014 MADD is a downstream target of PTEN in triggering apoptosis.
23457619 2013 MADD knock-down enhances doxorubicin and TRAIL induced apoptosis in breast cancer cells.
23443411 2013 MADD promotes the survival of human lung adenocarcinoma cells by inhibiting apoptosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22678883 2012 DENN/MADD/IG20 alternative splicing changes and cell death in Alzheimer's disease.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
22529996 2012 Cardiac myosin binding protein C and MAP-kinase activating death domain-containing gene polymorphisms and diastolic heart failure.
22482404 2012 [Expression of MADD in lung adenocarcinoma tissues and its effects on proliferation and apoptosis of lung adenocarcinoma A549 cells].
21887289 2011 Glucose-raising genetic variants in MADD and ADCY5 impair conversion of proinsulin to insulin.