Property Summary

NCBI Gene PubMed Count 35
Grant Count 16
R01 Count 12
Funding $2,729,591.61
PubMed Score 86.90
PubTator Score 75.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
systemic lupus erythematosus 2.200 0.000
malignant mesothelioma 3.100 0.000
psoriasis 3.000 0.000
cutaneous lupus erythematosus 4.900 0.000
posterior fossa group B ependymoma 1.700 0.000
glioblastoma 1.100 0.002
juvenile dermatomyositis 4.939 0.000
lung cancer -4.200 0.000
pancreatic cancer 1.800 0.001
Multiple Sclerosis 4.000 0.003
cystic fibrosis 2.800 0.001
adult high grade glioma 1.600 0.001
pilocytic astrocytoma 1.500 0.000
primary Sjogren syndrome 1.900 0.000
invasive ductal carcinoma 1.600 0.036
nasopharyngeal carcinoma 1.800 0.005
inflammatory breast cancer 2.600 0.002
lung carcinoma -1.500 0.000
breast carcinoma 1.500 0.000
ovarian cancer 1.800 0.028
dermatomyositis 2.500 0.014

Gene RIF (34)

PMID Text
25997337 Viperin inhibits viral replication by interactiing with host cell proteins and viral proteins. [review]
25814471 Viperin was localized in trophoblast cells. HCMV IE1 mRNA expression was significantly inhibited by viperin RNA interference.
25433308 data suggested that viperin impaired respiratory syncytial virus (RSV) transmission by inhibiting virus filament formation, providing a basis for its anti-virus activity in RSV-infected cells
25170834 HIV-1 Vpr upregulates the gene expression of RSAD2 in human monocyte-derived macrophages
24245804 These data suggest that viperin requires CIAO1 for [4Fe-4S] cluster assembly, and acts through an enzymatic, Fe-S cluster- and SAM-dependent mechanism to inhibit viral RNA synthesis.
23935494 The data indicate that viperin is the major effector underlying the ability of HCMV to regulate cellular lipid metabolism.
23638199 Viperin is induced following dengue virus type-2 (DENV-2) infection and has anti-viral actions requiring the C-terminal end of viperin.
23333304 HIV-1 Vpr upregulates the gene expression of RSAD2 in human monocyte-derived macrophages
23160199 viperin is a critical antiviral host protein that controls chikungunya virus infection.
23018837 inhibits replication of respiratory syncytial virus
More...

AA Sequence

MWVLTPAAFAGKLLSVFRQPLSSLWRSLVPLFCWLRATFWLLATKRRKQQLVLRGPDETKEEEEDPPLPT      1 - 70
TPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLV     71 - 140
RFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRW    141 - 210
CRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFL    211 - 280
ERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKY    281 - 350
IWSKADLKLDW                                                               351 - 361
//

Text Mined References (42)

PMID Year Title
25997337 2015 [Progress in studies of viperin, an important cellular antiviral factor].
25814471 2015 Viperin is induced following toll-like receptor 3 (TLR3) ligation and has a virus-responsive function in human trophoblast cells.
25433308 2015 Viperin protein expression inhibits the late stage of respiratory syncytial virus morphogenesis.
24245804 2014 Viperin is an iron-sulfur protein that inhibits genome synthesis of tick-borne encephalitis virus via radical SAM domain activity.
23935494 2013 Viperin regulates cellular lipid metabolism during human cytomegalovirus infection.
23638199 2013 Viperin is induced following dengue virus type-2 (DENV-2) infection and has anti-viral actions requiring the C-terminal end of viperin.
23509962 2013 A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.
23160199 2012 Viperin restricts chikungunya virus replication and pathology.
23018837 2013 Replication of respiratory syncytial virus is inhibited by the host defense molecule viperin.
22896602 2012 Viperin, MTAP44, and protein kinase R contribute to the interferon-induced inhibition of Bunyamwera Orthobunyavirus replication.
More...