Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.37
PubTator Score 1.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.300 0.008
oligodendroglioma -1.300 0.016
osteosarcoma -2.326 0.000
glioblastoma -1.400 0.000
medulloblastoma, large-cell -1.300 0.001
pediatric high grade glioma -1.200 0.000

Synonym

Accession Q8WXF8 Q8NBR2 Q8NES1 Q8TAA8 Q96D35
Symbols FLAME3
FLAME-3

Gene

 GO Component (2)

Gene RIF (2)

PMID Text
12527898 DEDD and DEDD2 may be important mediators for death receptors and that they may target caspases to the nucleus.
11965497 FLAME-3 forms nuclear complexes with the TFIIIC102 subunit of human transcription factor IIIC

AA Sequence

MALSGSTPAPCWEEDECLDYYGMLSLHRMFEVVGGQLTECELELLAFLLDEAPGAAGGLARARSGLELLL      1 - 70
ELERRGQCDESNLRLLGQLLRVLARHDLLPHLARKRRRPVSPERYSYGTSSSSKRTEGSCRRRRQSSSSA     71 - 140
NSQQGQWETGSPPTKRQRRSRGRPSGGARRRRRGAPAAPQQQSEPARPSSEGKVTCDIRLRVRAEYCEHG    141 - 210
PALEQGVASRRPQALARQLDVFGQATAVLRSRDLGSVVCDIKFSELSYLDAFWGDYLSGALLQALRGVFL    211 - 280
TEALREAVGREAVRLLVSVDEADYEAGRRRLLLMEEEGGRRPTEAS                            281 - 326
//

Text Mined References (12)

PMID Year Title
18989622 2009 Death effector domain-containing proteins.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14634625 2003 The death effector domain protein family.
12527898 2003 DEDD and DEDD2 associate with caspase-8/10 and signal cell death.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12235123 2002 DEDD regulates degradation of intermediate filaments during apoptosis.
More...