Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.37
PubTator Score 1.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.300 8.0e-03
glioblastoma -1.400 4.9e-05
medulloblastoma, large-cell -1.300 6.2e-04
oligodendroglioma -1.300 1.6e-02
osteosarcoma -2.326 3.7e-06
pediatric high grade glioma -1.200 4.1e-05

 GO Component (1)

Gene RIF (2)

AA Sequence

MALSGSTPAPCWEEDECLDYYGMLSLHRMFEVVGGQLTECELELLAFLLDEAPGAAGGLARARSGLELLL      1 - 70
ELERRGQCDESNLRLLGQLLRVLARHDLLPHLARKRRRPVSPERYSYGTSSSSKRTEGSCRRRRQSSSSA     71 - 140
NSQQGQWETGSPPTKRQRRSRGRPSGGARRRRRGAPAAPQQQSEPARPSSEGKVTCDIRLRVRAEYCEHG    141 - 210
PALEQGVASRRPQALARQLDVFGQATAVLRSRDLGSVVCDIKFSELSYLDAFWGDYLSGALLQALRGVFL    211 - 280
TEALREAVGREAVRLLVSVDEADYEAGRRRLLLMEEEGGRRPTEAS                            281 - 326
//

Text Mined References (12)

PMID Year Title