Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.94
PubTator Score 2.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Raynaud disease 6 3.833 1.9

Expression

Synonym

Accession Q8WXF5 Q496G6
Symbols

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
15853812 gammaN-crystallin represents an intermediate in the evolution of beta and gamma crystallins. Crygn is expressed in mice and other species but may be a pseudogene in humans.

AA Sequence

MAQRSGKITLYEGKHFTGQKLEVFGDCDNFQDRGFMNRVNSIHVESGAWVCFNHPDFRGQQFILEHGDYP      1 - 70
DFFRWNSHSDHMGSCRPVGMHGEHFRLEIFEGCNFTGQCLEFLEDSPFLQSRGWVKNCVNTIKVYGDGAA     71 - 140
WSPRSFGAEDFQLSSSLQSDQGPEEATTKPATTQPPFLTANL                                141 - 182
//

Publication (8)

PMID Year Title
24964093 2014 Prenatal tobacco smoke exposure is associated with childhood DNA CpG methylation.
19007775 2009 Genetics of crystallins: cataract and beyond.
17452356 2007 Non-EST-based prediction of novel alternatively spliced cassette exons with cell signaling function in Caenorhabditis elegans and human.
15853812 2005 gammaN-crystallin and the evolution of the betagamma-crystallin superfamily in vertebrates.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.