Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.95
PubTator Score 2.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Raynaud disease 6 3.881 1.9

Expression

Gene RIF (1)

AA Sequence

MAQRSGKITLYEGKHFTGQKLEVFGDCDNFQDRGFMNRVNSIHVESGAWVCFNHPDFRGQQFILEHGDYP      1 - 70
DFFRWNSHSDHMGSCRPVGMHGEHFRLEIFEGCNFTGQCLEFLEDSPFLQSRGWVKNCVNTIKVYGDGAA     71 - 140
WSPRSFGAEDFQLSSSLQSDQGPEEATTKPATTQPPFLTANL                                141 - 182
//

Text Mined References (8)

PMID Year Title