Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.17
PubTator Score 0.58

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma -1.200 3.4e-02
facioscapulohumeral dystrophy 1.700 1.9e-02
group 3 medulloblastoma 1.100 2.2e-02
pituitary cancer 1.100 1.8e-07
subependymal giant cell astrocytoma -1.263 5.0e-02

AA Sequence

MSRYTRPPNTSLFIRNVADATRPEDLRREFGRYGPIVDVYIPLDFYTRRPRGFAYVQFEDVRDAEDALYN      1 - 70
LNRKWVCGRQIEIQFAQGDRKTPGQMKSKERHPCSPSDHRRSRSPSQRRTRSRSSSWGRNRRRSDSLKES     71 - 140
RHRRFSYSQSKSRSKSLPRRSTSARQSRTPRRNFGSRGRSRSKSLQKRSKSIGKSQSSSPQKQTSSGTKS    141 - 210
RSHGRHSDSIARSPCKSPKGYTNSETKVQTAKHSHFRSHSRSRSYRHKNSW                       211 - 261
//

Text Mined References (8)

PMID Year Title