Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.17
PubTator Score 0.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
pituitary cancer 1972 1.75867822577146E-7
facioscapulohumeral dystrophy 286 0.0186257546433965
group 3 medulloblastoma 2254 0.021806347877282
ependymoma 2514 0.0336062229151059
subependymal giant cell astrocytoma 2287 0.049945351378786

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma -1.200 0.034
group 3 medulloblastoma 1.100 0.022
subependymal giant cell astrocytoma -1.263 0.050
pituitary cancer 1.100 0.000
facioscapulohumeral dystrophy 1.700 0.019

Synonym

Accession Q8WXF0 B2RA22 Q5T7K0 Q8WW25
Symbols SFRS19
SRrp35
SFRS13B

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

AA Sequence

MSRYTRPPNTSLFIRNVADATRPEDLRREFGRYGPIVDVYIPLDFYTRRPRGFAYVQFEDVRDAEDALYN      1 - 70
LNRKWVCGRQIEIQFAQGDRKTPGQMKSKERHPCSPSDHRRSRSPSQRRTRSRSSSWGRNRRRSDSLKES     71 - 140
RHRRFSYSQSKSRSKSLPRRSTSARQSRTPRRNFGSRGRSRSKSLQKRSKSIGKSQSSSPQKQTSSGTKS    141 - 210
RSHGRHSDSIARSPCKSPKGYTNSETKVQTAKHSHFRSHSRSRSYRHKNSW                       211 - 261
//

Text Mined References (8)

PMID Year Title
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
20516191 2010 A rational nomenclature for serine/arginine-rich protein splicing factors (SR proteins).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11684676 2001 Serine-arginine (SR) protein-like factors that antagonize authentic SR proteins and regulate alternative splicing.