Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.17
PubTator Score 0.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma -1.200 0.034
group 3 medulloblastoma 1.100 0.022
subependymal giant cell astrocytoma -1.263 0.050
pituitary cancer 1.100 0.000
facioscapulohumeral dystrophy 1.700 0.019

Synonym

Accession Q8WXF0 B2RA22 Q5T7K0 Q8WW25
Symbols SFRS19
SRrp35
SFRS13B

Gene

AA Sequence

MSRYTRPPNTSLFIRNVADATRPEDLRREFGRYGPIVDVYIPLDFYTRRPRGFAYVQFEDVRDAEDALYN      1 - 70
LNRKWVCGRQIEIQFAQGDRKTPGQMKSKERHPCSPSDHRRSRSPSQRRTRSRSSSWGRNRRRSDSLKES     71 - 140
RHRRFSYSQSKSRSKSLPRRSTSARQSRTPRRNFGSRGRSRSKSLQKRSKSIGKSQSSSPQKQTSSGTKS    141 - 210
RSHGRHSDSIARSPCKSPKGYTNSETKVQTAKHSHFRSHSRSRSYRHKNSW                       211 - 261
//

Publication (8)

PMID Year Title
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
20516191 2010 A rational nomenclature for serine/arginine-rich protein splicing factors (SR proteins).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11684676 2001 Serine-arginine (SR) protein-like factors that antagonize authentic SR proteins and regulate alternative splicing.