Property Summary

NCBI Gene PubMed Count 18
PubMed Score 30.00
PubTator Score 15.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Astrocytoma, Pilocytic -1.400 3.4e-03
atypical teratoid / rhabdoid tumor -1.900 3.2e-04
group 3 medulloblastoma -2.000 1.8e-02
interstitial cystitis -1.600 3.6e-03
intraductal papillary-mucinous neoplasm ... 1.700 1.5e-02
medulloblastoma, large-cell 1.100 2.6e-05
osteosarcoma 1.587 2.1e-03
ovarian cancer 1.200 7.7e-08
Pick disease 1.300 1.3e-02
pituitary cancer 1.100 5.5e-05
posterior fossa group B ependymoma 1.100 1.1e-03
subependymal giant cell astrocytoma 1.827 4.0e-02
tuberculosis 1.500 3.7e-05
ulcerative colitis -1.200 3.0e-07

Gene RIF (4)

AA Sequence

MTTLDHVIATHQSEWVSFNEEPPFPAHSQGGTEEHLPGLSSSPDQSESSSGENHVVDGGSQDHSHSEQDD      1 - 70
SSEKMGLISEAASPPGSPEQPPPDLASAISNWVQFEDDTPWASTSPPHQETAETALPLTMPCWTCPSFDS     71 - 140
LGRCPLTSESSWTTHSEDTSSPSFGCSYTDLQLINAEEQTSGQASGADSTDNSSSLQEDEEVEMEAISWQ    141 - 210
ASSPAMNGHPAPPVTSARFPSWVTFDDNEVSCPLPPVTSPLKPNTPPSASVIPDVPYNSMGSFKKRDRPK    211 - 280
STLMNFSKVQKLDISSLNRTPSVTEASPWRATNPFLNETLQDVQPSPINPFSAFFEEQERRSQNSSISST    281 - 350
TGKSQRDSLIVIYQDAISFDDSSKTQSHSDAVEKLKQLQIDDPDHFGSATLPDDDPVAWIELDAHPPGSA    351 - 420
RSQPRDGWPMMLRIPEKKNIMSSRHWGPIFVKLTDTGYLQLYYEQGLEKPFREFKLEICHEISEPRLQNY    421 - 490
DENGRIHSLRIDRVTYKEKKKYQPKPAVAHTAEREQVIKLGTTNYDDFLSFIHAVQDRLMDLPVLSMDLS    491 - 560
TVGLNYLEEEITVDVRDEFSGIVSKGDNQILQHHVLTRIHILSFLSGLAECRLGLNDILVKGNEIVLRQD    561 - 630
IMPTTTTKWIKLHECRFHGCVDEDVFHNSRVILFNPLDACRFELMRFRTVFAEKTLPFTLRTATSVNGAE    631 - 700
VEVQSWLRMSTGFSANRDPLTQVPCENVMIRYPVPSEWVKNFRRESVLGEKSLKAKVNRGASFGSTSVSG    701 - 770
SEPVMRVTLGTAKYEHAFNSIVWRINRLPDKNSASGHPHCFFCHLELGSDREVPSRFANHVNVEFSMPTT    771 - 840
SASKASVRSISVEDKTDVRKWVNYSAHYSYQVALGSIWLMLPTPFVHPTTLPLLFLLAMLTMFAW         841 - 905
//

Text Mined References (20)

PMID Year Title