Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.31
PubTator Score 2.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -2.600 9.3e-08
astrocytoma -1.200 1.5e-12
Astrocytoma, Pilocytic -1.900 6.1e-10
atypical teratoid / rhabdoid tumor -2.700 1.3e-10
ependymoma -1.500 1.8e-02
facioscapulohumeral dystrophy 1.400 8.1e-03
glioblastoma -2.300 1.5e-12
group 3 medulloblastoma -1.700 6.2e-06
medulloblastoma, large-cell -2.400 7.7e-07
osteosarcoma -3.389 7.9e-13
primitive neuroectodermal tumor -1.500 1.5e-04
psoriasis -1.400 9.3e-26

 GWAS Trait (1)

Gene RIF (3)

AA Sequence

MGKEQELVQAVKAEDVGTAQRLLQRPRPGKAKLLGSTKKINVNFQDPDGFSALHHAALNGNTELISLLLE      1 - 70
AQAAVDIKDNKGMRPLHYAAWQGRKEPMKLVLKAGSAVNIPSDEGHIPLHLAAQHGHYDVSEMLLQHQSN     71 - 140
PCMVDNSGKTPLDLACEFGRVGVVQLLLSSNMCAALLEPRPGDATDPNGTSPLHLAAKNGHIDIIRLLLQ    141 - 210
AGIDINRQTKSGTALHEAALCGKTEVVRLLLDSGINAHVRNTYSQTALDIVHQFTTSQASREIKQLLREA    211 - 280
SAALQVRATKDYCNNYDLTSLNVKAGDIITVLEQHPDGRWKGCIHDNRTGNDRVGYFPSSLGEAIVKRAG    281 - 350
SRAGTEPSLPQGSSSSGPSAPPEEIWVLRKPFAGGDRSGSISGMAGGRGSGGHALHAGSEGVKLLATVLS    351 - 420
QKSVSESGPGDSPAKPPEGSAGVARSQPPVAHAGQVYGEQPPKKLEPASEGKSSEAVSQWLTAFQLQLYA    421 - 490
PNFISAGYDLPTISRMTPEDLTAIGVTKPGHRKKIAAEISGLSIPDWLPEHKPANLAVWLSMIGLAQYYK    491 - 560
VLVDNGYENIDFITDITWEDLQEIGITKLGHQKKLMLAVRKLAELQKAEYAKYEGGPLRRKAPQSLEVMA    561 - 630
IESPPPPEPTPADCQSPKMTTFQDSELSDELQAAMTGPAEVGPTTEKPSSHLPPTPRATTRQDSSLGGRA    631 - 700
RHMSSSQELLGDGPPGPSSPMSRSQEYLLDEGPAPGTPPREARPGRHGHSIKRASVPPVPGKPRQVLPPG    701 - 770
TSHFTPPQTPTKTRPGSPQALGGPHGPAPATAKVKPTPQLLPPTERPMSPRSLPQSPTHRGFAYVLPQPV    771 - 840
EGEVGPAAPGPAPPPVPTAVPTLCLPPEADAEPGRPKKRAHSLNRYAASDSEPERDELLVPAAAGPYATV    841 - 910
QRRVGRSHSVRAPAGADKNVNRSQSFAVRPRKKGPPPPPPKRSSSALASANLADEPVPDAEPEDGLLGVR    911 - 980
AQCRRASDLAGSVDTGSAGSVKSIAAMLELSSIGGGGRAARRPPEGHPTPRPASPEPGRVATVLASVKHK    981 - 1050
EAIGPGGEVVNRRRTLSGPVTGLLATARRGPGESADPGPFVEDGTGRQRPRGPSKGEAGVEGPPLAKVEA   1051 - 1120
SATLKRRIRAKQNQQENVKFILTESDTVKRRPKAKEREAGPEPPPPLSVYHNGTGTVRRRPASEQAGPPE   1121 - 1190
LPPPPPPAEPPPTDLAHLPPLPPPEGEARKPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEV   1191 - 1260
KRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPS   1261 - 1330
PGAPALHVPAKPPRAAAAAAAAAAAPPAPPEGASPGDSARQKLEETSACLAAALQAVEEKIRQEDAQGPR   1331 - 1400
DSAAEKSTGSILDDIGSMFDDLADQLDAMLE                                          1401 - 1431
//

Text Mined References (9)

PMID Year Title