Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.29
PubTator Score 2.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
posterior fossa group A ependymoma -2.300 0.000
astrocytoma -1.200 0.000
glioblastoma -2.500 0.000
osteosarcoma -3.389 0.000
sonic hedgehog group medulloblastoma -2.700 0.000
atypical teratoid / rhabdoid tumor -2.700 0.000
medulloblastoma, large-cell -2.400 0.000
primitive neuroectodermal tumor -1.500 0.000
adult high grade glioma -2.600 0.000
pilocytic astrocytoma -1.900 0.000
psoriasis -1.400 0.000
facioscapulohumeral dystrophy 1.400 0.008

Gene RIF (2)

PMID Text
22153505 SAM domains of Caskin1 form a new type of SAM helical polymer.
21763699 Study shows that a short linear EEIWVLRK peptide motif from Caskin1 is necessary and sufficient for binding CASK.

AA Sequence

MGKEQELVQAVKAEDVGTAQRLLQRPRPGKAKLLGSTKKINVNFQDPDGFSALHHAALNGNTELISLLLE      1 - 70
AQAAVDIKDNKGMRPLHYAAWQGRKEPMKLVLKAGSAVNIPSDEGHIPLHLAAQHGHYDVSEMLLQHQSN     71 - 140
PCMVDNSGKTPLDLACEFGRVGVVQLLLSSNMCAALLEPRPGDATDPNGTSPLHLAAKNGHIDIIRLLLQ    141 - 210
AGIDINRQTKSGTALHEAALCGKTEVVRLLLDSGINAHVRNTYSQTALDIVHQFTTSQASREIKQLLREA    211 - 280
SAALQVRATKDYCNNYDLTSLNVKAGDIITVLEQHPDGRWKGCIHDNRTGNDRVGYFPSSLGEAIVKRAG    281 - 350
SRAGTEPSLPQGSSSSGPSAPPEEIWVLRKPFAGGDRSGSISGMAGGRGSGGHALHAGSEGVKLLATVLS    351 - 420
QKSVSESGPGDSPAKPPEGSAGVARSQPPVAHAGQVYGEQPPKKLEPASEGKSSEAVSQWLTAFQLQLYA    421 - 490
PNFISAGYDLPTISRMTPEDLTAIGVTKPGHRKKIAAEISGLSIPDWLPEHKPANLAVWLSMIGLAQYYK    491 - 560
VLVDNGYENIDFITDITWEDLQEIGITKLGHQKKLMLAVRKLAELQKAEYAKYEGGPLRRKAPQSLEVMA    561 - 630
IESPPPPEPTPADCQSPKMTTFQDSELSDELQAAMTGPAEVGPTTEKPSSHLPPTPRATTRQDSSLGGRA    631 - 700
RHMSSSQELLGDGPPGPSSPMSRSQEYLLDEGPAPGTPPREARPGRHGHSIKRASVPPVPGKPRQVLPPG    701 - 770
TSHFTPPQTPTKTRPGSPQALGGPHGPAPATAKVKPTPQLLPPTERPMSPRSLPQSPTHRGFAYVLPQPV    771 - 840
EGEVGPAAPGPAPPPVPTAVPTLCLPPEADAEPGRPKKRAHSLNRYAASDSEPERDELLVPAAAGPYATV    841 - 910
QRRVGRSHSVRAPAGADKNVNRSQSFAVRPRKKGPPPPPPKRSSSALASANLADEPVPDAEPEDGLLGVR    911 - 980
AQCRRASDLAGSVDTGSAGSVKSIAAMLELSSIGGGGRAARRPPEGHPTPRPASPEPGRVATVLASVKHK    981 - 1050
EAIGPGGEVVNRRRTLSGPVTGLLATARRGPGESADPGPFVEDGTGRQRPRGPSKGEAGVEGPPLAKVEA   1051 - 1120
SATLKRRIRAKQNQQENVKFILTESDTVKRRPKAKEREAGPEPPPPLSVYHNGTGTVRRRPASEQAGPPE   1121 - 1190
LPPPPPPAEPPPTDLAHLPPLPPPEGEARKPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEV   1191 - 1260
KRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPSLGASPAKPPS   1261 - 1330
PGAPALHVPAKPPRAAAAAAAAAAAPPAPPEGASPGDSARQKLEETSACLAAALQAVEEKIRQEDAQGPR   1331 - 1400
DSAAEKSTGSILDDIGSMFDDLADQLDAMLE                                          1401 - 1431
//

Text Mined References (8)

PMID Year Title
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22153505 2011 Tandem SAM domain structure of human Caskin1: a presynaptic, self-assembling scaffold for CASK.
21763699 2011 The molecular basis of the Caskin1 and Mint1 interaction with CASK.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12040031 2002 CASK participates in alternative tripartite complexes in which Mint 1 competes for binding with caskin 1, a novel CASK-binding protein.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.