Property Summary

NCBI Gene PubMed Count 15
Grant Count 5
R01 Count 5
Funding $385,562.5
PubMed Score 16.97
PubTator Score 10.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma 1.100 0.000
tuberculosis and treatment for 6 months -1.200 0.000
lung cancer 1.800 0.000
colon cancer 1.100 0.004
subependymal giant cell astrocytoma 1.226 0.017
acute myeloid leukemia -1.800 0.035
Breast cancer 1.100 0.000

Gene RIF (3)

PMID Text
22190034 HIV-1 Vpr is identified to have a physical interaction with gem (nuclear organelle) associated protein 6 (GEMIN6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
17023415 Gemin8 has an essential role in the proper structural organization of the SMN complex and the involvement of the heteromeric subunit containing Gemin6, Gemin7, Gemin8, and Unrip in the recruitment of Sm proteins to the snRNP assembly pathway
11748230 Gemin6 is a component of the SMN complex that localizes to gems and interacts with several Sm proteins of the spliceosomal snRNPs.

AA Sequence

MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVET      1 - 70
MNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYG     71 - 140
PENCSSSNEIILSRVQDLIEGHLTASQ                                               141 - 167
//

Publication (20)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22190034 2011 Global landscape of HIV-human protein complexes.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18984161 2008 An assembly chaperone collaborates with the SMN complex to generate spliceosomal SnRNPs.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17023415 2006 Gemin8 is required for the architecture and function of the survival motor neuron complex.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...