Property Summary

NCBI Gene PubMed Count 38
PubMed Score 85.30
PubTator Score 72.95

Knowledge Summary

Patent (6,865)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Cryptorchidism 296 6.855 3.4
Disease Target Count P-value
psoriasis 6694 1.1e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Testicular cancer 25 3.804 1.9
Infertility 188 3.53 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.100 1.1e-06

Gene RIF (35)

AA Sequence

MIVFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQGSMITPSCQKGYFPCGNLTKCLPRAFHCDGKDD      1 - 70
CGNGADEENCGDTSGWATIFGTVHGNANSVALTQECFLKQYPQCCDCKETELECVNGDLKSVPMISNNVT     71 - 140
LLSLKKNKIHSLPDKVFIKYTKLKKIFLQHNCIRHISRKAFFGLCNLQILYLNHNCITTLRPGIFKDLHQ    141 - 210
LTWLILDDNPITRISQRLFTGLNSLFFLSMVNNYLEALPKQMCAQMPQLNWVDLEGNRIKYLTNSTFLSC    211 - 280
DSLTVLFLPRNQIGFVPEKTFSSLKNLGELDLSSNTITELSPHLFKDLKLLQKLNLSSNPLMYLHKNQFE    281 - 350
SLKQLQSLDLERIEIPNINTRMFQPMKNLSHIYFKNFRYCSYAPHVRICMPLTDGISSFEDLLANNILRI    351 - 420
FVWVIAFITCFGNLFVIGMRSFIKAENTTHAMSIKILCCADCLMGVYLFFVGIFDIKYRGQYQKYALLWM    421 - 490
ESVQCRLMGFLAMLSTEVSVLLLTYLTLEKFLVIVFPFSNIRPGKRQTSVILICIWMAGFLIAVIPFWNK    491 - 560
DYFGNFYGKNGVCFPLYYDQTEDIGSKGYSLGIFLGVNLLAFLIIVFSYITMFCSIQKTALQTTEVRNCF    561 - 630
GREVAVANRFFFIVFSDAICWIPVFVVKILSLFRVEIPDTMTSWIVIFFLPVNSALNPILYTLTTNFFKD    631 - 700
KLKQLLHKHQRKSIFKIKKKSLSTSIVWIEDSSSLKLGVLNKITLGDSIMKPVS                    701 - 754
//

Text Mined References (39)

PMID Year Title