Property Summary

NCBI Gene PubMed Count 37
PubMed Score 81.19
PubTator Score 72.95

Knowledge Summary

Patent (6,865)

TINX Plot

  Disease Sources (3)

Disease Target Count
Cryptorchidism 67
Disease Target Count P-value
psoriasis 6685 1.12990832334354E-6
Disease Target Count Z-score Confidence
Testicular cancer 24 3.791 1.9
Infertility 163 3.436 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.100 0.000

Synonym

Accession Q8WXD0 B1ALE9 Q3KU23
Symbols LGR8
GREAT
GPR106
INSL3R
LGR8.1
RXFPR2

Gene

PANTHER Protein Class (1)

PDB

2M96  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Zebrafish OMA Inparanoid

  TechDev Info (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
489043 confirmatory 176 / 182 / 111 qHTS Assay for Agonists of the Relaxin Receptor RXFP1: RXFP2 Hit Validation
602258 confirmatory 5 / 7 / 55 qHTS Assay for Agonists of the Relaxin Receptor RXFP1: RXFP2 SAR

Gene RIF (34)

PMID Text
24983702 Mapping key regions of the RXFP2 low-density lipoprotein class-A module that are involved in signal activation.
23539510 Findings suggest a novel and gender-specific role for INSL3 and cognate receptor RXFP2 signaling in ocular surface homeostasis.
23024363 Identification of key residues essential for the structural fold and receptor selectivity within the A-chain of human gene-2 (H2) relaxin
22973049 These results provide new mechanistic insights into the binding and activation events of RXFP1 and RXFP2 by their native hormone ligands.
22737225 relaxin-2 and its receptors RXFP1 and RXFP2 are expressed in GSV and their expression is significantly decreased in varicose GSV
21789898 higher expression of LGR8 may facilitate tumor invasiveness in the early clinical stage of hepatocellular carcinoma.
20636340 haplotype analysis of the RXFP2 gene in T222P carriers and their parents showed that this variant is linked to the previously inferred C-C-G-A-13 haplotype and consequently provides further support to the 'founder effect' hypothesis
20636340 Observational study of gene-disease association. (HuGE Navigator)
20560146 Data show that synthetic parallel dimer of the B-chain of INSL3 is a potent inhibitor of the native peptide's binding to its receptor, RXFP2.
19416191 Data link RXFP2 gene mutations with human osteoporosis.
More...

AA Sequence

MIVFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQGSMITPSCQKGYFPCGNLTKCLPRAFHCDGKDD      1 - 70
CGNGADEENCGDTSGWATIFGTVHGNANSVALTQECFLKQYPQCCDCKETELECVNGDLKSVPMISNNVT     71 - 140
LLSLKKNKIHSLPDKVFIKYTKLKKIFLQHNCIRHISRKAFFGLCNLQILYLNHNCITTLRPGIFKDLHQ    141 - 210
LTWLILDDNPITRISQRLFTGLNSLFFLSMVNNYLEALPKQMCAQMPQLNWVDLEGNRIKYLTNSTFLSC    211 - 280
DSLTVLFLPRNQIGFVPEKTFSSLKNLGELDLSSNTITELSPHLFKDLKLLQKLNLSSNPLMYLHKNQFE    281 - 350
SLKQLQSLDLERIEIPNINTRMFQPMKNLSHIYFKNFRYCSYAPHVRICMPLTDGISSFEDLLANNILRI    351 - 420
FVWVIAFITCFGNLFVIGMRSFIKAENTTHAMSIKILCCADCLMGVYLFFVGIFDIKYRGQYQKYALLWM    421 - 490
ESVQCRLMGFLAMLSTEVSVLLLTYLTLEKFLVIVFPFSNIRPGKRQTSVILICIWMAGFLIAVIPFWNK    491 - 560
DYFGNFYGKNGVCFPLYYDQTEDIGSKGYSLGIFLGVNLLAFLIIVFSYITMFCSIQKTALQTTEVRNCF    561 - 630
GREVAVANRFFFIVFSDAICWIPVFVVKILSLFRVEIPDTMTSWIVIFFLPVNSALNPILYTLTTNFFKD    631 - 700
KLKQLLHKHQRKSIFKIKKKSLSTSIVWIEDSSSLKLGVLNKITLGDSIMKPVS                    701 - 754
//

Text Mined References (38)

PMID Year Title
24983702 2014 Mapping key regions of the RXFP2 low-density lipoprotein class-A module that are involved in signal activation.
23539510 2013 Insulin-like factor 3 promotes wound healing at the ocular surface.
23024363 2012 Identification of key residues essential for the structural fold and receptor selectivity within the A-chain of human gene-2 (H2) relaxin.
22973049 2012 The different ligand-binding modes of relaxin family peptide receptors RXFP1 and RXFP2.
22737225 2012 A novel role for relaxin-2 in the pathogenesis of primary varicosis.
21789898 2011 Expression of LGR8 and related biomarkers in hepatocellular carcinoma: correlation with clinicopathological parameters.
20636340 2011 Further insights into the role of T222P variant of RXFP2 in non-syndromic cryptorchidism in two Mediterranean populations.
20560146 2011 Design and development of analogues of dimers of insulin-like peptide 3 B-chain as high-affinity antagonists of the RXFP2 receptor.
19416191 2009 New roles for INSL3 in adults.
19416190 2009 Mutations in INSL3 and RXFP2 genes in cryptorchid boys.
More...